KEGG   Legionella pneumophila subsp. pneumophila HL06041035: LPV_1930Help
Entry
LPV_1930          CDS       T02174                                 

Definition
Alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lph00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LPV_1930
Enzymes [BR:lph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LPV_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1957641..1959866)
Genome map
AA seq 741 aa AA seqDB search
MAESKLEIVNKREREESVILDGNGILRCYNMFPTQFGSIEEMIDYLPQLQAMGFNAVWIN
PVQTAGDVQGLFKRDKTIGVRAYNEVTRSLYAMTDCDLISPYFNPLPPNVDPKLKKQLDM
QAMQKFTSEARNNGLVPMFDLVLNHVAADSRHRKEHPEWFHKDVHPDFKDAIAFDYSDPQ
IRDEIIEQFWKPYIYKYMIDYGFEGVRIDAVGYLNPELRKQIYAYIYDLAEQFNKPKPVI
LDELLFSGSQKLTDVVDGLLLPEKGPTHITRGTYYAQRDGYGGLPGWCKEEEGVKAQVVF
LDKQKKLHPHAKGGCIAFSGNHDHNSLAMTILEEMAEHRLANHHTLHGAQEKFKHERSYD
YDEALESVLRYSFVKDIQNEILNGNESTIKEVETRMREKIAFCALTSSGGWYALSGDETG
DLLAKPVFRRVHALDQTYYAQRTHIIFDKKYPDNKVAMEVLTEMAIENIQKEKAGSIYNS
LQHDKQSQERLLVPYLETLQNQINCGDTVVCKAFQEKLAQKNITIGFTEENYNPAPRTPQ
NGWNGQHDMKKFMFEINSILSSLPSSNMGFWSEVIPIQSKPGLLAVVRKNGLGLSSETDI
AIVNMDPSQKVELTRDDIHQLACNFQKRVIPEYTYYNDGKDKQYNWHTNNPDFNMAYHTV
MSCIEAKRIHVDDSIKTNFPVHSANPYGMFSKKQSSKMNIAKIAKMSGEDTTLIEKGTND
TEGIIHDGEQIQPTITVENKK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcaaaattagagatagtcaataaaagagaacgcgaagaaagtgtaatcctg
gatggtaatgggattttacgttgttataacatgtttcctactcaatttggaagcatagag
gagatgattgactatcttcctcaattacaggccatgggatttaatgctgtatggataaat
cctgtacaaacagcaggggatgttcagggtttatttaagcgtgataagacaattggcgtc
agagcttataatgaggtgacaagaagtctatatgctatgacagattgtgatctgataagt
ccttattttaacccgctccctcccaatgttgatcctaagttgaaaaagcagctcgatatg
caagcaatgcagaagttcacatcagaagcccgcaataatggtttggtaccgatgtttgat
ttggttttaaatcacgttgccgccgattcacggcacagaaaagaacatcctgaatggttt
cataaggatgtccatcctgattttaaggatgctatcgcgtttgactacagtgaccctcaa
atccgagatgaaattattgaacaattttggaagccttatatttataaatacatgattgat
tatggctttgagggtgttcgcattgatgctgtaggctatttaaatccagaattacgcaaa
caaatttatgcttatatttatgatcttgcggagcagtttaataaacctaaacctgttata
ttagatgaacttcttttcagtgggagccagaagcttaccgatgtggttgatggtttgttg
cttccagaaaaagggccaacccatattactcgaggtacctattatgcgcaaagagatggt
tatggtggtttacccgggtggtgtaaggaggaggagggagttaaggctcaagtagtattc
ctggataaacaaaagaaattgcatccccatgccaaaggcggatgtattgctttctccggt
aatcatgatcataactccttagccatgacaatattggaagaaatggcagaacaccgtttg
gcaaatcatcacactttgcacggtgcgcaagaaaaatttaaacatgaaaggagctatgat
tatgacgaagctttagagtcagtcctgcgctattcttttgtgaaagatatccaaaatgag
attctaaacggtaatgaatcaacaatcaaagaagtagaaacaagaatgcgtgaaaaaata
gctttctgtgctttaacatcaagcggcgggtggtatgctctatcaggtgatgaaacaggc
gatttattggcaaaacctgtattcagaagggtccatgctctggatcaaacctattatgca
caacgcactcatataatctttgataaaaaatatcccgacaacaaagtagctatggaggta
ttaaccgaaatggctatagagaatatccaaaaagaaaaagctggaagcatctataacagt
ttacagcatgataaacaatcgcaagagcgattactagttccttatcttgagactttgcaa
aatcaaattaattgtggcgatacagttgtttgcaaagcattccaagaaaaacttgcccag
aaaaatataacgattggtttcacagaagaaaattataatcccgctccaagaacacctcaa
aatggttggaacggtcaacatgatatgaaaaaatttatgtttgaaatcaatagtatatta
agttctttgccaagttccaatatgggattttggagtgaagttatcccaatccagtcaaaa
ccagggttgcttgcagtagtacgtaagaatgggctaggcttaagttctgaaactgatatt
gcaatcgttaatatggatccaagtcaaaaagttgagttaaccagagacgatattcatcaa
ttagcctgtaatttccagaaacgagtaattcctgaatatacttattacaatgatggtaaa
gacaaacagtataattggcatacaaataatcctgattttaatatggcttatcatacagtg
atgtcctgtatcgaagccaaaaggatacatgttgatgattcgatcaaaactaatttccct
gttcattcagcaaatccctatggcatgtttagcaaaaagcaatcatcgaaaatgaatata
gccaagatagcaaaaatgtctggggaagataccactctaattgaaaaaggtactaatgat
actgagggtatcatacacgatggagagcaaattcaacccacaataactgtagaaaacaaa
aaataa

DBGET integrated database retrieval system