KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_00664Help
Entry
LBPG_00664        CDS       T02808                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LBPG_00664
Enzymes [BR:lpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LBPG_00664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1159481..1160071
Genome map
AA seq 196 aa AA seqDB search
MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKRVILMTSAVDDRAGVGMIASRIGLERTAI
PITHETNLYDIIKATDPKAACVLIDEAQFLQKHHIFEAARVVDELHIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCAKKAIMNLRIHDGQPVYEGKQVLIGGNESYYPVC
RHHYFHPPLKQIDPTD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcttttctttcgttacggtgcgatgaactccgggaaaagtattgaaatcctg
aaggttgcgcataactatgaagaacaaaataaacgcgtaattttgatgacaagtgccgtg
gatgatcgtgccggcgtcggtatgattgccagtcgaatcggcttagaacgcacggcaatt
ccgattacacacgaaaccaacctttacgacatcatcaaggcaactgatcctaaggctgcc
tgtgtgttgatcgatgaggcgcagttcctgcagaaacatcacatttttgaagcagcacgt
gtggttgatgaattacatattccagtcatggcgttcggtttgaaaaatgatttccgcaat
gagctgtttgaaggttcaaaatatttattactctatgcggataaaattgaagaaatgaaa
acgatctgctggttttgtgccaaaaaagcgattatgaatttacggattcatgatggccag
ccagtctacgaaggcaaacaagtactgattggtgggaatgagtcgtattatccagtttgc
cgacatcattattttcatccgccattgaagcagattgaccccaccgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system