KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_00986Help
Entry
LBPG_00986        CDS       T02808                                 

Definition
DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:lpi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    LBPG_00986
Enzymes [BR:lpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     LBPG_00986
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     LBPG_00986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1737901..1738749)
Genome map
AA seq 282 aa AA seqDB search
MPELPEVETVRRSLLPLVKNKVITAINTNWEKILINGLATFQKEIVGSEITTIDRRGKYL
LMRLSNGETIISHLRMEGRYYVVKDANTPFDKHDHVTFTFQDGSQLRYRDLRKFGRMRLI
KTGQEDQVTALAKLGPEPTPSTFDEADFAQRLKRHHKPIKSVLLDQTVVAGVGNIYADEV
LWLSRLNPLQPADTLKSKEIKTLHDAIIQELNAAIAAGGTSAHTYVDAEGNRGSFQNALH
VYDREGTPCDRCGTTIVKIKVGQRGTHYCPHCQPLHQRRRPA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaagtggaaacagttcgccgctcgcttctgccgttagtcaaaaat
aaagtcattaccgccatcaacactaactgggagaaaatcctgatcaatgggttggcgact
tttcaaaaggaaattgtcggcagtgagatcacgaccattgatcggcgcggcaagtatctt
ttgatgcgcctcagcaatggtgaaacgatcatcagccatctgcgtatggaagggcgttac
tatgttgtcaaagatgcaaacacaccttttgataagcacgatcacgttacgttcactttt
caggatggcagtcagttgcgctatcgggatctgcgaaagtttgggcggatgcggctgatc
aaaaccgggcaggaggatcaggtcacagcacttgctaaacttgggccggaaccaacccca
agcacctttgacgaagcggactttgcccagcgcttgaaacgtcatcataaaccgattaag
tcggttttactcgatcaaaccgtggtcgctggtgtgggcaatatttacgctgatgaggta
ctttggttaagtcggctcaatccgctgcagccagctgataccttgaaatctaaagaaatc
aaaacactgcatgacgcgattatccaagaattaaacgcagccattgcggcaggcggcacc
agcgcgcatacgtatgttgatgcagaaggcaatcgcggttcttttcaaaatgccttgcac
gtctatgatcgggaaggtaccccgtgcgatcgctgcggcacgacgattgtcaaaattaag
gttggtcagcgcggaacccattactgcccacactgtcagccattacatcaaaggaggcgg
ccagcgtga

DBGET integrated database retrieval system