KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_01003Help
Entry
LBPG_01003        CDS       T02808                                 

Definition
penicillin-binding protein
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lpi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LBPG_01003
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LBPG_01003
Enzymes [BR:lpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     LBPG_01003
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     LBPG_01003
Glycosyltransferases [BR:lpi01003]
 Polysaccharide
  Bacterial polysaccharide
   LBPG_01003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1755611..1757653)
Genome map
AA seq 680 aa AA seqDB search
MQFLSRIWQGTRWFFRRFQVIRWLILIGLTVMLGFSAWFTYKAKTADVENIKSTLQTKTV
IYDANNEEAGTLYGQKGTYVELKAISPQVQNAVISTEDRTFYTNGGFSIKGILRSALNYV
IHHGQIMGGGSTITQQLAKNTLLTQKQTVMRKAQELFMAIQLNKVYSKQDILAMYLNNAY
FGNGVWGVQDAAKRYFGKDASQLDASEGAILAGMLRNPSYYNPADHMDNALSRRNVVLQL
MVDNKKLTQAQANAAKAQSVQVVDTFSTANSQKYPSYFDSVIEEARSEGISVDDILNKGY
KIYTNLDQTYQRNLQNSFAQDWAFPANAADGKQVQGASIVLDPKTGGVRAVVGNRGEHTF
LGFNYATQLRNSPGSTIKPLMVYTPALENGYHYDSVLKDEKLSYGKNNYTPTNATGTYLG
TVPMYKALADSINAPAVWLLNKIGVQKGVTSLDRFGIQLKESDQNLAAALGGLKNGVSPL
MMARAYAVFANGGKLPTTHFIRKIVDASGQTVVDNSHPTMRQIISKKVAQEMTSMMIGTF
NEGTGQTAKPAGYTIAGKTGSTEVPSSWGYGTKDQWVIGYTPDIVNATWIGYPTTDSQHF
LQGTSTSGVAPLFKLEMTNLMPNTPQTAFDTKDAAQMASIQTPSSGDKTWQGIQDSIEKG
IDSAKQTVGQWYDNIKGWFK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcttatcacgaatttggcagggaacacggtggtttttccgccgatttcaggtg
attcgttggctgattttaattggtctgacagtcatgctcgggttctctgcttggtttact
tataaagccaaaaccgccgatgttgaaaacatcaagagtaccttacaaacaaaaaccgtc
atttatgacgctaacaacgaagaagccggcacactgtacggccaaaaagggacctacgtc
gagttaaaggcgattagtccgcaagtacaaaatgccgttatctcgacggaagaccgtacg
ttttataccaatggcggtttttcaatcaaagggattcttcgctctgctttgaattatgtc
atccaccatggccaaatcatgggtggtggtagtacgattacccaacaattggcgaagaat
accttgctgacgcaaaagcagacggtgatgcgcaaggcccaagaactatttatggccatc
cagttgaataaagtttactccaaacaagacattcttgcgatgtacctcaataatgcttat
tttggcaatggggtctggggggttcaagatgctgctaagcggtattttggcaaagatgcc
agccagcttgatgcgagtgaaggggcaattctggcggggatgttacggaatcctagctac
tataaccccgctgatcacatggacaatgctttgtcgcgccgcaatgtcgttttgcaattg
atggtggacaataagaagctcacgcaggcgcaggccaatgcggcaaaagcgcagtcagtg
caggttgtcgatactttttcaacggccaacagtcaaaaatatccgtcttattttgactcc
gtcattgaagaggcgcgcagtgaaggtattagtgtcgatgatattttgaacaaaggttat
aaaatttataccaatttggatcaaacttatcaacgcaaccttcaaaacagctttgctcaa
gactgggcgtttccggcaaatgccgcagatggtaagcaggttcaaggggcttccatcgtg
cttgatccgaaaacaggcggtgtcagggcggtcgttggtaatcgcggtgagcataccttc
ttagggtttaactacgcaacacaacttcgcaattcgccgggttccacgatcaagccgttg
atggtttatacaccagcacttgaaaatggttatcattatgattctgtcttgaaggacgag
aaacttagttacggtaaaaataattatacgccgaccaatgcaaccggcacctatttaggt
actgtcccgatgtataaagcgttggccgattcgatcaacgcgccggctgtttggctgctt
aataagattggtgtacaaaaaggggtcactagcttagatcggtttggcatccaactaaaa
gaaagcgatcagaatcttgctgctgcacttggtggccttaaaaatggggtttcaccgctg
atgatggcacgggcctatgcggtgtttgcgaatggcggtaaattgccaacgactcacttc
attcgcaaaattgtcgatgcgtcaggtcaaacggtggtcgacaactcacatccaacgatg
cgtcaaatcatatcaaaaaaagtggctcaggaaatgacgagcatgatgatcggaacgttt
aacgaagggaccggtcaaactgctaaaccagctggctacacaatcgccgggaaaactggc
agtactgaggtcccaagtagttggggctatggcactaaggatcagtgggtcattggctat
acgccagatattgtaaatgcgacctggattggttacccgacaaccgacagtcagcatttc
cttcaaggcaccagcacgtctggggtggcaccgttatttaaactcgaaatgacgaatcta
atgccgaatacgccacaaaccgcgtttgacacgaaagatgctgcacaaatggctagcatc
caaacaccatccagtggcgacaaaacatggcaaggaattcaggatagtatcgagaaaggc
atagacagtgccaagcaaactgtgggacaatggtatgataatatcaagggctggtttaaa
tag

DBGET integrated database retrieval system