KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_01240Help
Entry
LBPG_01240        CDS       T02808                                 

Definition
sugar-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LBPG_01240
Enzymes [BR:lpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LBPG_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2655808..2656536)
Genome map
AA seq 242 aa AA seqDB search
MTEQYVFENERKDLAEVAREMFMRKNTNVAGGNISVRITPDKDFDYGDIHIKAGKDYLIM
TPTMMSEAWYAKLQPTQILVVDLETGKLIDGVGRLTREINMHEEAYRANDKIRCVYHSHA
EESMFWATAGLDMPNVTEVTEEVGPIRVLPYAPACSKELADTVYNGLKEVGDAAKEHIFL
LNSHGVLITSEDLHHATEILETVEWNAKIAYQQTVFMKLGLLESYQSCGKTTDGMLKEPL
KA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaatatgtctttgaaaatgagcggaaagatttagctgaagtggcccgcgaa
atgttcatgcggaagaataccaatgttgcaggtggcaacattagcgttcggatcacccct
gacaaggattttgattacggggatattcatattaaagctggcaaagattatctgattatg
acgccaaccatgatgtctgaagcctggtatgccaagttgcaaccaacccaaattttggtg
gttgatcttgaaaccggcaaactgattgacggcgttggtcgtctgacccgtgaaatcaac
atgcatgaagaagcttatcgggccaacgacaagatccgttgtgtctatcattcccatgct
gaagaatccatgttctgggcaacagccggattggatatgccaaatgtcaccgaagttact
gaagaagttggtccgattcgggtgctgccatacgcaccagcctgctccaaggaacttgca
gacacggtctacaatggcctgaaggaagtcggagatgcggcaaaagagcacatcttcctc
ttaaacagccatggcgttttgatcacttccgaagacttgcatcatgccacagaaattctg
gaaaccgttgaatggaatgcgaagattgcctatcaacagacggtcttcatgaaactggga
ttgttagaaagctatcagtcctgcggtaaaacaactgatggcatgttgaaggaacctttg
aaagcctag

DBGET integrated database retrieval system