KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_02500Help
Entry
LBPG_02500        CDS       T02808                                 

Definition
ribokinase family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lpi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LBPG_02500
Enzymes [BR:lpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LBPG_02500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
351809..352738
Genome map
AA seq 309 aa AA seqDB search
MPNHVVVIGSINVDSILHIQRLPQPGETIKMDTFSQAAGGKGANQAVAAARSGAKTSFIG
RVGDDANAAFMRGELVKNQIDTQYVATTVGTQTGQAYILLQASGQNSIIIQHGANFEVTP
ADVQRAADLIQSADFVVAEFETPVDATAEAFKIAKAAGKMTILNPAPAQKDLPAALLKNV
DLIAPNETESELITGIPVVDEDSMRASAAYYHELGIRGVIITLGSKGSFISLDGEATIVP
AFKVKAVDTTAAGDTFIGALASVLQTDLKNIVTAATYASMASSFTVQKLGAFPSIPMGDE
VRAALAKIK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatcatgttgttgtcatcggcagtatcaatgtggatagcatcttgcacattcaa
cggttgccacaaccgggagaaacgatcaaaatggacaccttttcgcaagcggctggcggt
aaaggggcgaatcaagcagttgcggctgcgcgttcgggggccaaaaccagttttattggc
cgagttggtgacgatgccaacgctgccttcatgcgcggtgaacttgtcaagaaccaaatc
gacacccaatatgtggcgacaacggttggcacgcaaaccggtcaggcttacattttgctg
caagcctctggccaaaattccattatcatccagcatggcgctaattttgaggtgacacca
gcagatgtgcaacgagcagccgacttgattcagtctgccgactttgtggtcgcggaattt
gaaacgccggtggatgcgacggcagaggccttcaaaattgccaaagctgctgggaagatg
accatcttaaacccagcgccggcacagaaggatttgccagcagctttgctgaaaaatgtg
gatctcatcgcaccgaacgaaaccgaaagcgagctgatcaccggcattccggtggtagat
gaagacagcatgcgggcttcggcagcttattatcatgaattaggcattcgcggggtgatc
atcactttaggatcaaaaggctccttcatctcgctggatggcgaagcaaccatcgtgcca
gcctttaaagtcaaggctgtcgacaccaccgcggccggcgacactttcattggcgccttg
gccagcgttttacagacagatctcaaaaacatcgtcacggctgcgacatacgcaagcatg
gcgagctccttcacagtccaaaaactcggcgccttcccgtccattccgatgggggatgag
gtgcgggcggcgttagcgaaaatcaagtga

DBGET integrated database retrieval system