KEGG   Lactobacillus plantarum JDM1: JDM1_0204Help
Entry
JDM1_0204         CDS       T00946                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lpj00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lpj00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
218238..218723
Genome map
AA seq 161 aa AA seqDB search
MAESVYDFTETEMSGAPLDLSQYRGQVLLIVNTASNCGLAPQFKGLEELYQKYQQEGLVV
LGLPSNQFHQEKADDDETHDYCQRHYGVTFPMTKRVMVNGDDADPLFTYLKQAAGHGRIK
WNFTKFLIGRDGRVLERYAPTTRPATFEAAIRDALADRSED
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcagtgtatgattttacagaaactgagatgagtggtgcgccacttgacttg
tcacaatatcgcggtcaggtcttgctaatcgtgaatacggctagcaactgtggcctggcg
ccacagtttaaaggattagaagaactttatcagaagtatcagcaggagggcctagtggtc
ttgggattgccatccaatcaatttcatcaagaaaaggcggatgacgatgagacccatgac
tattgtcaacggcactacggggtaacgttccccatgaccaaacgggtgatggttaatggt
gatgacgctgatccgttatttacttacctcaaacaggcggcgggacatggtcgaatcaag
tggaatttcacaaaattcctgattggtcgtgatggccgtgtgctcgaacgctatgcccca
acgacacggccggcaacatttgaagcagcgattcgtgatgccttggctgatcgttcagaa
gattaa

DBGET integrated database retrieval system