KEGG   Lactobacillus plantarum JDM1: JDM1_0332Help
Entry
JDM1_0332         CDS       T00946                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lpj00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
348514..350031
Genome map
AA seq 505 aa AA seqDB search
MTDKYIMAIDEGTTSTRAIIFDHAGHKVADSQREFPQYFPQPGWVEHNANEIWNAVLSTI
ANAFIESGIKPAQISGIGITNQRETTIVWDKQTGLPIYNAIVWQSRQTAPIAEKLVKDGY
GDLIHQHTGLVTDAYFSATKIRWILDHVKGAQERAEKGELLFGTIDTWLLWKLTGGATHV
TDYSNASRTMLFNIHDLKWDDQILQLLNIPAAMLPEVRTNSEVYGKTKDYHFFGSEVPIS
GMAGDQQAALFGQLAFEPGTVKNTYGTGAFIVMNTGEKPQLSDNNLLTTIGYGINGKVYY
ALEGSIFVAGSAIQWLRDGIRLVESAPDSERAARESHNENEVYVVPAFTGLGAPYWDSEA
RGSVFGLTRGTTREDFIKATLQALAYQTRDVVETMKKDSGIEIPVLKVDGGAARNDWLMQ
FQADILDTQIMRAANLETTALGAAFLAGLSVGYWQDLEELKASYKPGTSFDPEMGPAERT
NLYEGWQAAVKATQVFKHTPYHAGK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagtacattatggcaattgacgaagggacaaccagtacccgcgccattatc
tttgaccatgcgggccataaagtggccgactcacaacgggaatttccacaatatttcccg
cagccgggctgggtcgaacataatgccaatgaaatctggaatgctgtcttgtctactatt
gcgaatgccttcattgaatcgggaatcaaacccgctcaaattagtggtattggaattacg
aatcaacgggaaacaaccatcgtttgggacaagcaaactggcttgccaatctataacgca
atcgtgtggcaatcacggcaaaccgcgccgattgctgagaagctggttaaagatggctat
ggtgatttgattcatcaacatacgggactcgtcacagacgcttacttctcggcaactaaa
attcgctggatcttagaccacgtgaagggggcccaagaacgagccgaaaagggtgaatta
ctctttggaacgatcgatacgtggctcctatggaaacttaccggtggggccacccacgtg
acggattattccaatgccagtcggacgatgctcttcaatattcatgatttgaagtgggac
gaccagattttgcaattattaaatattccagcggcgatgttgccagaagttcgcactaat
tctgaagtttatggcaagaccaaggactatcatttctttgggtcggaagttccaattagt
gggatggctggtgatcaacaagcggccttgtttggtcaactggcgtttgaaccgggaacc
gtgaagaatacttacgggactggggcttttatcgtgatgaacaccggtgaaaaaccccaa
ttatccgataataatctattgaccacgatcggttacggcatcaacggtaaagtgtactac
gccttggaagggtcaattttcgttgccggttcagcgattcagtggttgcgtgatgggatt
cgcctagttgaaagcgctcccgattctgaacgggcggcgcgcgaatcgcataatgaaaat
gaagtctatgtggttccggcctttactggtttaggggcaccatattgggactctgaagca
cgcggatcagtctttggcttgacgcgtggcacgactcgtgaagattttattaaagcaacc
ttgcaagcattggcttaccaaacgcgggacgtggttgaaacaatgaagaaagattccggt
attgagattccagtattaaaagttgacggtggcgctgctcgtaatgactggttgatgcaa
tttcaggcggatatcttggatacgcaaattatgcgggctgctaatctggaaacgacggcg
cttggtgctgccttcttagccgggcttagcgttggttattggcaggatttggaagaatta
aaagcgtcgtataagcccggcacgagttttgaccctgagatggggccagctgaacggacg
aacttatacgagggatggcaggcagcggtcaaagcgacccaagtctttaagcacacccca
taccacgcaggaaaatag

DBGET integrated database retrieval system