KEGG   Lactobacillus plantarum JDM1: JDM1_0389Help
Entry
JDM1_0389         CDS       T00946                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00900  Terpenoid backbone biosynthesis
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JDM1_0389 (ispE)
Enzymes [BR:lpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     JDM1_0389 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACT61278
Position
410774..411640
Genome map
AA seq 288 aa AA seqDB search
MQIVEKAPAKINLGLDTLFEHPNGDKEWDMVMTSVDLADYVMLESLHTNRIEVVTDSGFL
PNDRRNLAFQAVSVLKRYCHVDRGVRIKIRKAIPVAAGLGGGSSDAAAVLRGLNRMWNLH
LDLATLARLGLQVDSDVPYCVYSQTAHVTGKGDVVTPLPKLPPMWIILAKPKVSVSTPNI
LRQVNYERIDQHPNIEVLLTGIQRQDFAKIFANMGNVLEPITAKRYPEILQIKRQLLTFG
ADAAQMSGTGPTVFGVCRKQSRAQRVYNSLKGFCREVYLVRPVNLNEH
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatcgttgaaaaagcaccggccaaaatcaatttaggactggataccttatttgaa
catccaaatggggataaagagtgggacatggtgatgacgtcggtcgatctggccgactat
gttatgttggaatcattgcatacgaaccgaatcgaagtggtcaccgatagtggctttttg
ccgaatgatcgccgtaacttagcttttcaagcggtgagtgttttaaaacggtattgtcat
gttgatcggggtgtccgtatcaaaataagaaaggccattccggtagcggctggtctagga
ggcggctcatctgatgccgccgctgttttacggggcttgaaccggatgtggaatctccac
ttggacttagccacgttagcacgtttgggattgcaagtagattcggatgtgccatactgt
gtctacagtcagacggcccacgtgacgggaaaaggcgatgtagtcaccccgctacctaag
ttgccgccgatgtggattattctcgcgaaaccgaaagtcagtgtgtcaacgccaaatatt
ttgcggcaggtcaattacgagcgtatcgaccagcatcccaatattgaggtcttgttgact
ggcattcaacggcaggattttgcgaagatttttgcgaatatgggcaacgttttggagcca
attacggcaaaacggtacccagagattttacagattaagcggcaattgttaacgtttggg
gcggatgcggcccagatgagcggcaccggaccaactgtgttcggtgtgtgtcgcaaacaa
tcgcgggcgcaacgcgtgtataattccttgaagggtttttgtcgggaagtataccttgtg
cggccagttaatttaaatgaacattag

DBGET integrated database retrieval system