KEGG   Lactobacillus plantarum JDM1: JDM1_0541Help
Entry
JDM1_0541         CDS       T00946                                 

Gene name
rpiA1
Definition
ribose-5-phosphate isomerase A
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM1_0541 (rpiA1)
   01230 Biosynthesis of amino acids
    JDM1_0541 (rpiA1)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JDM1_0541 (rpiA1)
Enzymes [BR:lpj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     JDM1_0541 (rpiA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(573245..573928)
Genome map
AA seq 227 aa AA seqDB search
MNQDQLKQLVGQKAVEYIQDGMQVGLGTGSTVKFMVDALGERVKNEHLNIVGVSTSDRTA
AQAKALGIPMKSVDEVDHLDLTIDGADEIADDFQGVKGGGAALLFEKIVAINSDKVMWIV
DESKMVHQLGAFGLPVEVIPYGSQHVFEKMAARGYNPVFRKVNDELVRTDSNNIIIDLHI
DPITDPHALAEDLIHMVGVVEHGLFLDMVNTVIVGHANGPEVIEARP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggatcagttaaaacaacttgttggtcaaaaagccgttgaatacattcaagac
ggcatgcaggtcggccttggaaccggctcaaccgttaaattcatggttgatgctctgggt
gaacgggtcaaaaatgaacatttaaacattgtcggcgtctcaacctccgaccgaaccgct
gcccaagctaaggcgctcggtatcccgatgaaatccgttgacgaagtcgaccatctcgac
ttaacgatcgacggtgccgacgaaatcgccgatgatttccaaggcgttaagggtggtggc
gccgccttactcttcgaaaaaatcgttgccatcaattctgataaagtcatgtggattgtt
gatgaaagcaaaatggtccatcaattaggtgcctttggcttacccgttgaagtgattcct
tacggcagccaacatgtctttgaaaaaatggctgcccggggctataacccagtattccgt
aaagtcaacgatgaactcgtccggaccgattctaataatattatcatcgatttacacatc
gacccaatcacggatccccacgctttagccgaagatttaattcacatggttggtgtggtt
gaacacggcctgttcttagacatggtcaacactgtcattgtcggtcatgccaatggtccc
gaggttatcgaagcacgaccatag

DBGET integrated database retrieval system