KEGG   Lactobacillus plantarum JDM1: JDM1_0546Help
Entry
JDM1_0546         CDS       T00946                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lpj00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
578927..580417
Genome map
AA seq 496 aa AA seqDB search
MAKSKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGKFILRIEDTDLKRNVKDGEKSQ
MDNLTWLGIDWDEGPDKGGDFGPYRQSERKSIYDPLIQQLIDEGKAYESYMTEDELSAQR
EAQKARKEMPHYVYEFAGMTEDEKQAKIAAAKAAGIQPVIRFHVPENTTYAWDDMVKGKV
SFESKTVGGDFVIKKRDGMPTYNFAVVVDDHMMEISHVFRGDDHVANTPKQLMIYEAFGW
QPPKFGHMSLIINTETGKKLSKRDETVLQFIEQYRELGYLPEAMLNFIILLGWSPVGESE
LFSKREFIKMYDEKRLSKSPAAFDGKKLEWVNNQYIKKADENEVFAMSIRQLIKAGRLPQ
RPDMSQIEWTRTLVSLFKNQMSYTGQIVDLADLFFNGPADINDEAKAELDNDTALPVLKE
FRQRIEDIDVFEATAIQKTIKSIQKDTKIKGRALYMPIRIAVSHEMHGPELPETIELLGR
ETTKKHLDAMIAELAK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaagagcaagattcgtgtgcgttacgcaccaagtccaactggccatttacacatt
ggtaatgctcggactgcattgtttaactatttatttgcccggcataataagggaaagttc
attcttcggattgaagacaccgatttaaagcggaatgttaaagacggtgaaaagagtcag
atggacaatttgacgtggttagggattgattgggacgaaggtccggataagggtggcgac
tttggcccttaccgtcaatcagaacggaaatcaatctatgacccgttgattcaacaatta
attgatgaaggtaaagcttacgaatcttacatgacggaagacgaattgtcggcacaacgt
gaagcccaaaaagcgcgtaaggaaatgccacactacgtctacgaatttgctggcatgacg
gaagacgaaaaacaggcgaagatcgcggctgctaaggcggctggtatccaacccgttatt
cgcttccacgtcccagaaaatacgacctatgcttgggatgacatggttaaaggtaaagtt
tcgtttgaatccaagacggttggtggcgactttgtcatcaagaagcgtgacgggatgcca
acgtacaactttgcggtggttgttgatgaccatatgatggaaattagccacgtcttccgt
ggtgatgaccacgttgccaacacgcctaagcaattgatgatttatgaagcctttggttgg
caaccaccgaagtttggccacatgagcttaattatcaataccgaaaccggtaagaagtta
agcaagcgtgacgaaaccgtattgcaatttatcgaacaataccgtgaattgggttactta
ccagaagcaatgcttaacttcatcatcctactaggatggtcaccagttggcgaaagtgaa
ttgttcagtaagcgcgaattcatcaaaatgtatgatgaaaagcggttgagcaagtcacca
gcagcttttgatggcaagaagttggaatgggtgaacaaccagtacattaagaaggctgac
gaaaatgaagtctttgcaatgtcaattcgccaattgatcaaggctggccggttaccacaa
cgcccagatatgagccagattgaatggacacggacgttggtttcattatttaagaaccag
atgagctatactggtcaaatcgttgatttagcagatctcttcttcaatggtccggctgat
atcaatgatgaagctaaggccgaacttgataatgacacggcactccctgtcttgaaggaa
ttccggcaacgaatcgaagatattgacgtcttcgaagcaaccgcaattcaaaagacgatc
aagagcattcaaaaggatacgaagatcaagggccgggcattatacatgccgatccggatc
gccgtttcccacgaaatgcacgggccagaattaccagaaacgattgaattattagggcgt
gaaacgaccaaaaagcatctcgatgctatgattgcggaactcgccaagtaa

DBGET integrated database retrieval system