KEGG   Lactobacillus plantarum JDM1: JDM1_0626Help
Entry
JDM1_0626         CDS       T00946                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00040  Pentose and glucuronate interconversions
lpj00052  Galactose metabolism
lpj00500  Starch and sucrose metabolism
lpj00520  Amino sugar and nucleotide sugar metabolism
lpj01100  Metabolic pathways
lpj01130  Biosynthesis of antibiotics
Module
lpj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JDM1_0626 (galU)
   00052 Galactose metabolism
    JDM1_0626 (galU)
   00500 Starch and sucrose metabolism
    JDM1_0626 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    JDM1_0626 (galU)
Enzymes [BR:lpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     JDM1_0626 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACT61514
Position
657488..658408
Genome map
AA seq 306 aa AA seqDB search
MSKVRKAVIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVDEARKSGIEDIVIVTGKS
KRSIEDYYDSNPELEDNLRAKHKEEMLKLVQETTDINLYFIRQSHPRGLGDAVLTAKAFV
GDEPFVVMLGDDLMEDKVPLTKQLMNSYDKTHASTLAVMKVPHEEVSKYGVINPESEKEP
GLYNVNNFVEKPSPEDAPSDLAIIGRYLLTPEIFDVLENQKPGKGDEIQLTDAIDTLNKT
QRVFAHEFKGTRHDVGYKFGYLKTTIEYGLTHPDVKADLRTYIKDLGAKLSKEDSAAPKT
TKKPTK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagttagaaaagccgttatcccagcggccggattaggaacacggtttttgcct
gctactaaggcgatgcctaaagaaatgttaccaatcgttgataaaccaacgattcagttc
attgttgacgaagctcgtaaatcggggatcgaagacattgttatcgtcacgggtaagagc
aagcgtagtattgaagattactatgattctaacccagaattagaggataacttacgggct
aagcacaaggaagaaatgctcaagctggttcaagaaaccacagacattaacttgtacttt
atccggcaatcacatccacgtggtttgggcgatgccgttttaacggctaaagctttcgtt
ggtgacgaacctttcgtcgtcatgcttggtgatgatttaatggaagacaaagtaccgtta
accaaacagttaatgaatagctatgacaagacacatgcgtcaacgttagctgttatgaag
gttcctcatgaggaagtttctaagtatggggtcatcaatcctgaaagtgaaaaggaaccg
ggcctatacaacgttaataactttgttgaaaagccatcacctgaagatgcgcctagtgat
cttgctatcattggtcgttacttattaacaccagaaatttttgatgttcttgaaaaccaa
aaacctggtaagggtgacgaaattcaattgacggatgccattgatacgttgaacaagact
cagcgggtctttgcccatgaatttaaggggactcggcacgatgttggctacaagtttggc
tacttgaagacgacgatcgaatacgggttaactcatccggatgttaaggctgacttgcgg
acttacatcaaggatcttggtgctaagttatctaaagaagatagcgccgctcctaaaaca
acgaagaaaccaactaaataa

DBGET integrated database retrieval system