KEGG   Lactobacillus plantarum JDM1: JDM1_0655Help
Entry
JDM1_0655         CDS       T00946                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00010  Glycolysis / Gluconeogenesis
lpj00051  Fructose and mannose metabolism
lpj00562  Inositol phosphate metabolism
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01120  Microbial metabolism in diverse environments
lpj01130  Biosynthesis of antibiotics
lpj01200  Carbon metabolism
lpj01230  Biosynthesis of amino acids
Module
lpj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lpj_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_0655 (tpiA)
   00051 Fructose and mannose metabolism
    JDM1_0655 (tpiA)
   00562 Inositol phosphate metabolism
    JDM1_0655 (tpiA)
Enzymes [BR:lpj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     JDM1_0655 (tpiA)
Exosome [BR:lpj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   JDM1_0655 (tpiA)
  Exosomal proteins of bladder cancer cells
   JDM1_0655 (tpiA)
  Exosomal proteins of melanoma cells
   JDM1_0655 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: ACT61543
Position
693053..693811
Genome map
AA seq 252 aa AA seqDB search
MRTPIIAGNWKMNKTASEALAFVNAVKDQLPDPSKVESVVAAPALFLQEMVEAAKGSDLK
IAAENAYFEDAGAFTGEISPAALADLGVDYVVIGHSERRGYFHETDEDINKKAHAIFKNG
MKPIICCGESLEQREAGEAESWVSGQIKAALKDLSADQVSSLVIAYEPIWAIGTGKTATS
DQAEEICAVVRKTVADLYSQEVADKVRIQYGGSVKPANVNELMGKDDIDGGLVGGASLQP
DSFLELVNYQNN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacacctattattgccggtaactggaaaatgaacaaaacagctagcgaagcttta
gctttcgttaatgctgttaaggatcaattaccagatccatcaaaagttgaatcagtcgtt
gctgccccagcccttttcttacaagaaatggttgaagctgccaagggttctgatttaaag
attgctgctgaaaatgcttattttgaagatgctggggcatttactggtgaaatttcacca
gctgccttagctgacttaggcgttgattacgttgttattggtcattcagaacgtcgcggt
tattttcacgaaactgacgaagacattaacaaaaaggcacacgctatcttcaagaacggc
atgaagccaatcatttgctgtggcgaatcattagaacaacgtgaagccggcgaagcagaa
tcatgggtttcaggccaaatcaaggctgctttgaaggacttatcagctgaccaagtaagt
tcattggttattgcctacgaaccaatctgggccatcggtactggtaagactgctacgagt
gaccaagctgaagaaatttgtgcggttgttcgtaagactgttgctgacctttactcacaa
gaagttgctgataaagttcggattcaatacggtggtagtgttaaaccagccaacgttaac
gaattaatgggcaaagatgatatcgacggtggtttagtcggtggtgcttcattacaacct
gattcattcttggaacttgttaattaccaaaataactaa

DBGET integrated database retrieval system