KEGG   Lactobacillus plantarum JDM1: JDM1_0655Help
Entry
JDM1_0655         CDS       T00946                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM1_0655 (tpiA)
   01230 Biosynthesis of amino acids
    JDM1_0655 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_0655 (tpiA)
   00051 Fructose and mannose metabolism
    JDM1_0655 (tpiA)
   00562 Inositol phosphate metabolism
    JDM1_0655 (tpiA)
Enzymes [BR:lpj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     JDM1_0655 (tpiA)
Exosome [BR:lpj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   JDM1_0655 (tpiA)
  Exosomal proteins of bladder cancer cells
   JDM1_0655 (tpiA)
  Exosomal proteins of melanoma cells
   JDM1_0655 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
693053..693811
Genome map
AA seq 252 aa AA seqDB search
MRTPIIAGNWKMNKTASEALAFVNAVKDQLPDPSKVESVVAAPALFLQEMVEAAKGSDLK
IAAENAYFEDAGAFTGEISPAALADLGVDYVVIGHSERRGYFHETDEDINKKAHAIFKNG
MKPIICCGESLEQREAGEAESWVSGQIKAALKDLSADQVSSLVIAYEPIWAIGTGKTATS
DQAEEICAVVRKTVADLYSQEVADKVRIQYGGSVKPANVNELMGKDDIDGGLVGGASLQP
DSFLELVNYQNN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacacctattattgccggtaactggaaaatgaacaaaacagctagcgaagcttta
gctttcgttaatgctgttaaggatcaattaccagatccatcaaaagttgaatcagtcgtt
gctgccccagcccttttcttacaagaaatggttgaagctgccaagggttctgatttaaag
attgctgctgaaaatgcttattttgaagatgctggggcatttactggtgaaatttcacca
gctgccttagctgacttaggcgttgattacgttgttattggtcattcagaacgtcgcggt
tattttcacgaaactgacgaagacattaacaaaaaggcacacgctatcttcaagaacggc
atgaagccaatcatttgctgtggcgaatcattagaacaacgtgaagccggcgaagcagaa
tcatgggtttcaggccaaatcaaggctgctttgaaggacttatcagctgaccaagtaagt
tcattggttattgcctacgaaccaatctgggccatcggtactggtaagactgctacgagt
gaccaagctgaagaaatttgtgcggttgttcgtaagactgttgctgacctttactcacaa
gaagttgctgataaagttcggattcaatacggtggtagtgttaaaccagccaacgttaac
gaattaatgggcaaagatgatatcgacggtggtttagtcggtggtgcttcattacaacct
gattcattcttggaacttgttaattaccaaaataactaa

DBGET integrated database retrieval system