KEGG   Lactobacillus plantarum JDM1: JDM1_0811Help
Entry
JDM1_0811         CDS       T00946                                 

Gene name
murE1
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diami nopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    JDM1_0811 (murE1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JDM1_0811 (murE1)
Enzymes [BR:lpj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     JDM1_0811 (murE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(870552..872033)
Genome map
AA seq 493 aa AA seqDB search
MQASQLINSLKFKQVQPALTTDFDVTMLTQDTREVQPGAMFIAVVGYHVDGHDLVDQAIG
KGAKIIVASKPLDVNVPVIYVENTERAMAILADVFYGAPSQKMRMIGVTGTNGKTTVTHL
IEQIYRDQQQATGLIGTMYRKIKDEKLPTANTTPDAITTQRTLAAMRDAGVETVAMEVSS
IALVLGRVWGIDYDIAVFTNLTQDHLDFHKTMAKYTEAKAMLFAQLGNKYSADGTNKVAV
LNTDDPVGREFEQYTAAHVLTFGLKPDAMINAQNVEIKSHGTEFDLSVFGHVTHVTMQLI
GQFNVYNMLAAFAAAYASGIPEDQIIKSLEKVTGVKGRFQSVPSHTGVSVIVDYSHTPDG
LLNALETIQDFATKDIYCVVGCGGDRDKTKRPKMAKIAVEHSTKPIFTSDNPRTEDPTMI
LNDMVAGVPNADVPVYEDRHVAIAKAIEAAQPGDVVLIAGKGHEDYQIIGRTKHHFDDSE
EAAKALALKPTID
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaagtcaattaattaatagtttaaaattcaagcaggttcagcccgccttgacc
acggactttgatgtcaccatgctgacgcaggatacccgcgaagttcagcccggcgccatg
tttattgccgtcgttggttatcacgtcgacggtcacgacctcgttgatcaggccatcgga
aaaggggccaagatcatcgtggcgtcaaaacctttagacgtcaacgtgccggtcatctac
gttgaaaacaccgaacgcgctatggcaattctcgccgacgttttctatggggcacctagt
caaaagatgcgaatgattggggtgacgggtaccaatggtaagaccactgtcacccacctg
atcgaacaaatctatcgtgaccagcagcaagccacaggcctcatcgggaccatgtatcgc
aagatcaaggacgaaaaactgccaactgccaacaccacccccgacgccatcacaacgcaa
cggaccctagcggccatgcgggatgccggtgttgaaactgtcgccatggaagtttcttca
attgccctcgtactcggacgggtctgggggattgattacgacatcgccgttttcacgaac
ttgacgcaagaccatttggatttccacaaaacaatggctaagtacacggaagccaaggcc
atgctctttgcacaactgggcaataagtacagcgccgacggaactaataaggtcgctgtt
ctgaacaccgatgatcccgttggccgtgaatttgaacagtacacggcagcgcacgtactg
acatttgggctcaaaccagatgccatgatcaacgcacaaaatgttgaaatcaagagccat
gggactgaatttgacctctccgtcttcggccacgtaacccacgtgacgatgcaactgatt
ggccagttcaacgtgtacaacatgctggcggcctttgccgcagcttacgctagtggcatc
cccgaagaccaaatcattaagtcactggagaaggttaccggcgttaagggccgcttccaa
tccgttccttcccacacgggtgtcagtgtcatcgttgactactcacacactccggacggc
ttattgaatgccctagaaacgattcaagatttcgcgactaaggatatttattgcgtcgtc
ggctgtggtggtgatcgcgacaagacgaaacggccaaagatggctaaaattgctgtcgaa
cacagtactaaaccaatctttacttctgacaatcctcggacggaagacccaaccatgatt
ctaaatgacatggttgccggcgtgccaaacgccgacgtgcccgtctacgaagaccgccac
gttgccatcgccaaggccattgaagcagcacaacccggcgacgttgttttaatcgctggt
aagggccacgaagattatcaaatcatcggccggactaagcatcactttgatgacagtgaa
gaagctgctaaagcactagctctgaaaccaacgattgattaa

DBGET integrated database retrieval system