KEGG   Lactobacillus plantarum JDM1: JDM1_0852Help
Entry
JDM1_0852         CDS       T00946                                 

Gene name
rplW
Definition
50S ribosomal protein L23
Orthology
K02892  
large subunit ribosomal protein L23
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Ribosome
Class
Genetic Information Processing; Translation; Ribosome [PATH:lpj03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918553..918846
Genome map
AA seq 97 aa AA seqDB search
MEARDVILRPVVTESSMADLDDKRYTFDVNVQATKTQVKKAIEEIFDVKVVKVNVMNVKG
KLKRQGRYAGYTKKRRKAIVTLSSDSNEIKLFNDDQQ
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggaagcacgcgatgtaattttacgtcctgtagttactgaatcatcaatggctgacttg
gacgacaagcgctacacatttgatgtcaacgtacaggcaacgaaaacccaagttaaaaaa
gcaatcgaagaaatcttcgatgttaaagtcgttaaagtgaacgttatgaacgttaaagga
aaacttaagcgccaaggtcgttacgccggctacactaagaagcgtcgtaaggctattgtt
accttaagttctgattctaacgaaatcaagttgttcaacgacgatcaacaataa

DBGET integrated database retrieval system