KEGG   Lactobacillus plantarum JDM1: JDM1_0852Help
Entry
JDM1_0852         CDS       T00946                                 

Gene name
rplW
Definition
50S ribosomal protein L23
Orthology
K02892  
large subunit ribosomal protein L23
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    JDM1_0852 (rplW)
Ribosome [BR:lpj03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    JDM1_0852 (rplW)
  Bacteria
    JDM1_0852 (rplW)
  Archaea
    JDM1_0852 (rplW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918553..918846
Genome map
AA seq 97 aa AA seqDB search
MEARDVILRPVVTESSMADLDDKRYTFDVNVQATKTQVKKAIEEIFDVKVVKVNVMNVKG
KLKRQGRYAGYTKKRRKAIVTLSSDSNEIKLFNDDQQ
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggaagcacgcgatgtaattttacgtcctgtagttactgaatcatcaatggctgacttg
gacgacaagcgctacacatttgatgtcaacgtacaggcaacgaaaacccaagttaaaaaa
gcaatcgaagaaatcttcgatgttaaagtcgttaaagtgaacgttatgaacgttaaagga
aaacttaagcgccaaggtcgttacgccggctacactaagaagcgtcgtaaggctattgtt
accttaagttctgattctaacgaaatcaagttgttcaacgacgatcaacaataa

DBGET integrated database retrieval system