KEGG   Lactobacillus plantarum JDM1: JDM1_1116Help
Entry
JDM1_1116         CDS       T00946                                 

Gene name
pepV
Definition
(GenBank) dipeptidase PepV
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00300  Lysine biosynthesis
lpj01100  Metabolic pathways
lpj01120  Microbial metabolism in diverse environments
lpj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    JDM1_1116 (pepV)
Enzymes [BR:lpj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     JDM1_1116 (pepV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACT62003
Position
1201211..1202614
Genome map
AA seq 467 aa AA seqDB search
MSVDWKNEATKHQDDYLADLTTMLRVPSFRDDSQATDDAPLGPGPKQALTTFLAIAERDG
FKTKNIDNLVGYAEIGEGDETLAILAHVDEMPAGNGWDTDPFEPTIKDGKMYARGVSDDK
GPGMAAYYGLKIVKELGLKLNKKIRFIVGTDEESNWTGMKRYFEVEPAPTLGFSPDAMFP
LINGEKGNVSLQLHFGHEDNGDFNLVSFDSGLRENMVPRDAEAVVATDDNEQLAADFTAF
LDQQPVTGELTVVPEGVKLEVVGKAAHGMEPRNGINAGTYLATFLTNYAFADDAAAFLDF
VANKLHDDSRANQLGLAYKDDVMGDLTMNVGLLSFDHQKGGALTLNFRYPKGIEPADLTA
KVQAQLPAGATVTQGDFMVPHYVDPEDPIVKDLMDVYRRQTGDTASQPQIVGGGTYGRMM
ARGVAFGALFPDTEDTMHQANEFQPIDELMAAMAIYAESIAVLATDK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgattggaaaaatgaagcaactaagcatcaagatgattatttagcagattta
accaccatgctccgcgtaccgagctttcgtgacgatagccaggcgacggatgatgcaccc
ttaggccctggtcctaagcaagcgttaaccacgtttttagcgattgcggaacgcgatggc
tttaagaccaagaacattgataacttggtcggttatgctgaaattggtgagggggatgaa
accttggcaattttagcccatgtggatgaaatgcctgctggtaacggctgggatacggac
cccttcgaaccaaccatcaaggatggcaagatgtatgcccgcggcgtttccgacgataaa
ggcccgggaatggcggcctactatggcttaaagattgtcaaagaacttggcttgaagctc
aataagaagattcgctttatcgttgggacagatgaggaaagtaattggactggaatgaaa
cgctactttgaagttgaaccagcgccaaccttgggcttctctccagatgccatgttcccg
ttgatcaatggtgaaaagggaaatgtgagtctgcaattacacttcggtcatgaagataat
ggcgactttaaccttgtttcttttgattctggcttgcgtgaaaatatggtgccgcgtgat
gccgaagccgtggtcgcgacggatgacaacgagcagttggcggccgacttcacagcgttt
ctggaccagcaaccagtaactggtgaattaacggtcgttcctgaaggcgttaagctggaa
gttgttggaaaggccgcccatgggatggaaccacgtaacgggatcaatgccggaacctac
cttgcaacgttcttgactaactatgcctttgctgatgatgccgctgctttcttagacttc
gtggctaataagctacacgatgattcacgggcgaaccagttaggcttagcttacaaggat
gacgttatgggtgatttgacgatgaatgtcgggttactcagcttcgaccatcaaaagggt
ggtgcgttaacgttgaacttccgttatccgaagggaatcgaacctgctgatttaacggcg
aaagtccaagcacagttaccagctggtgccacggtcacgcagggtgacttcatggtgcca
cattacgttgaccctgaagacccgatcgtcaaggatttgatggacgtttaccggcgtcaa
actggtgacacggcctcacaaccacaaattgttggtggtgggacttatggccggatgatg
gctcgtggggttgcctttggggcactcttcccagataccgaagatacgatgcaccaagcc
aatgaattccaaccaattgacgaattaatggctgcaatggcgatttacgctgaatcaatt
gccgtgttagcaaccgacaaatag

DBGET integrated database retrieval system