KEGG   Lactobacillus plantarum JDM1: JDM1_1263Help
Entry
JDM1_1263         CDS       T00946                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    JDM1_1263 (fpg)
Enzymes [BR:lpj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     JDM1_1263 (fpg)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     JDM1_1263 (fpg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1361025..1361849
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETVRRGLNRLVSGATIASIEVFWPKIINNDVDSFKQRLANQTIQTIDRRGKYL
LFRFSNGLTMVSHLRMEGKYNVVPRGEDQGKHTHVIFHLTDDRDLLYNDTRKFGRMTLVP
TGEESTVAGLRTIGPEPVAEQLTLAYMTATFGKSKKMIKPLLLDQSKIAGIGNIYADETL
WMSKIHPMRPANSLTTDEIATLRQNIIDEMAMAIKGHGTTVHSFSTAFGEAGQFQNHLHV
YGREGEPCERCGTIIEKIKVAQRGTHFCPLEQRL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaagttgaaactgttcgtcgcggcttaaatcgtctggttagtggg
gcaacgattgctagtatcgaggttttttggccgaaaattattaataatgatgtcgatagt
ttcaaacagcgtttagccaaccaaacgatccagaccattgatcggcgggggaagtattta
ttgtttcgctttagcaatggtctgacgatggtgtcgcatttgcggatggaaggcaagtat
aatgttgtaccgcgtggtgaagatcaaggtaaacacacgcacgtgatcttccatctgacc
gatgatcgtgatttgttgtacaacgatacgcgtaagttcgggcgaatgacgctcgtgccg
accggtgaagaaagcacggtggcgggattgcggacaattggcccggaacccgttgctgaa
cagttaacactggcttatatgacggctacttttggcaagtcgaaaaagatgatcaagcca
ctattgttggatcaaagtaagattgcgggcattgggaatatttacgcggacgaaacgcta
tggatgagtaagattcatccaatgcggcctgctaattcgctaactactgatgagattgct
acattgcgccaaaacattattgatgaaatggcgatggcaattaaaggtcacggcaccact
gttcattcattttcaacggcatttggtgaggccggtcagtttcaaaatcacttacacgtc
tatggtcgtgaaggggagccttgcgaacggtgtggcacaattattgagaaaatcaaagtg
gcacagcgagggacccatttttgcccgttagaacaacggttgtag

DBGET integrated database retrieval system