KEGG   Lactobacillus plantarum JDM1: JDM1_1318Help
Entry
JDM1_1318         CDS       T00946                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM1_1318 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_1318 (glk)
   00052 Galactose metabolism
    JDM1_1318 (glk)
   00500 Starch and sucrose metabolism
    JDM1_1318 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    JDM1_1318 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    JDM1_1318 (glk)
   00524 Butirosin and neomycin biosynthesis
    JDM1_1318 (glk)
Enzymes [BR:lpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     JDM1_1318 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1416908..1417870
Genome map
AA seq 320 aa AA seqDB search
MERKLIGVDLGGTTTKFAILTENGDIQQKWSIETTILDEGAHIVPNIIDSINHHIELYKM
DRSQFIGIGMGTPGTVDLDNGTVIGAYNLNWKTLQPVKAQIEKGTGIKFTLDNDANVAAL
GERWKGAGENGSDVVFVTLGTGVGGGIIADGRLLHGIAGGAGEIGHVTVEPNGYMCTCGK
KGCLEQYASATGVVHVARDMAEEFSGASKLKQLLDNGEEISSKITFDLAKEGDVLAKRVV
DRVSYYLGLALANVGNTMNPSSIIIGGGVSAAGDFLLDQVISYFNQFTFPTIRDTTALKL
AVLGNDAGVIGAGSLAQRFI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtaagttaatcggagtcgaccttggtgggacgacaactaagtttgccatttta
acagaaaatggtgatattcaacaaaagtggagtattgaaaccacgattttagatgaaggg
gcccacattgtgcctaacatcatcgattccatcaaccaccacattgagttatataagatg
gaccgttctcaatttatcggaattggaatggggactcccgggaccgttgatttggataat
ggtacggttatcggtgcctacaacttaaactggaagaccttacaaccagttaaggctcaa
attgaaaagggaactggcatcaaatttacgctggataacgacgctaacgttgctgcactt
ggcgaacgttggaagggcgctggcgaaaacggtagtgacgttgtctttgtaacgcttgga
actggtgttggtggtgggatcatcgccgatggccgtttactccatggtattgccggtggt
gccggtgaaattggtcacgtaacggttgaaccaaacggctacatgtgtacttgtggtaag
aaaggttgtttggaacaatacgcttctgcaactggtgtcgttcacgttgctcgcgatatg
gcagaagaattctctggtgcttctaagttgaaacaattattagacaacggtgaagaaatt
agttcaaagatcactttcgatttagctaaagaaggcgatgtcttggctaaacgcgttgtt
gatcgggtttcttattacttaggcttggcattagctaatgtcgggaacacgatgaaccca
tcttcaatcattatcggtggtggggtttcagctgctggtgatttcttattagatcaagtc
atcagttactttaaccaattcacattcccaacgattcgcgacacgactgctttgaagtta
gcggtcttaggtaacgacgctggtgttatcggagcaggttcattggcccaacggtttatt
taa

DBGET integrated database retrieval system