KEGG   Lactobacillus plantarum JDM1: JDM1_1390Help
Entry
JDM1_1390         CDS       T00946                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01130  Biosynthesis of antibiotics
lpj01230  Biosynthesis of amino acids
Module
lpj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    JDM1_1390 (trpC)
Enzymes [BR:lpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     JDM1_1390 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh DHO_dh QRPTase_C PDZ
Motif
Other DBs
NCBI-ProteinID: ACT62277
Position
1488094..1488876
Genome map
AA seq 260 aa AA seqDB search
MILDQLVQASQQRVQKVPVRERVKRIQQARKMTTPVLSFEAMLAQPGLQLIGEVKRASPS
KGLIAAEFDYLQIAQDYVAAGIDAISVLTEPRYFKGQLSYLQAIAQTVSVPTLRKDFIVA
ASQIASARIAGASAVLLIVAILTPVQLQAFITLAHELNLSALVEVHTTAEIKQAVAAGAR
IIGINNRNLKDFSVNFATSCQLRQAVPAECYVVAESGIQTATQAQQLAAAGFDAMLVGET
LMRAPDKGQAVMQLRAGVRG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatcaactcgtccaggcgagtcagcaacgggttcagaaggtgccagttagg
gagcgtgtgaagcgcattcaacaagctcgaaaaatgaccacccccgttttatcatttgaa
gcaatgctggcccagccgggcttacagcttattggtgaagttaagcgggcgtcaccttct
aaggggctgattgcggctgagtttgactatttacagattgcgcaagactatgttgctgct
gggatcgatgccatctcagtgttgaccgaaccccggtattttaaaggacagttgtcttac
ttacaagccattgcgcaaacggtctcggtacccacattacgtaaagattttattgtggct
gctagtcagattgcgagtgctcgtattgctggtgctagtgcggttttattgattgttgct
attttaacaccggttcaactgcaggctttcattacgttggctcatgagctgaatttaagt
gcgctagttgaagtccatacaacggctgagattaagcaagcggtggcggctggggcccgg
attattggcattaataatcggaatttgaaagatttcagtgtcaattttgcaacgagctgt
cagttacggcaagcagttccagctgagtgttatgtggtcgctgagtctggtattcaaacg
gccacacaggctcaacagttggccgctgctggctttgacgccatgctagttggcgaaaca
ttgatgcgtgcaccagataaaggtcaagccgtcatgcaattgcgggcgggggtgcgtgga
tga

DBGET integrated database retrieval system