KEGG   Lactobacillus plantarum JDM1: JDM1_1393Help
Entry
JDM1_1393         CDS       T00946                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00260  Glycine, serine and threonine metabolism
lpj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01130  Biosynthesis of antibiotics
lpj01230  Biosynthesis of amino acids
Module
lpj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JDM1_1393 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    JDM1_1393 (trpB)
Enzymes [BR:lpj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     JDM1_1393 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA DUF561 GcpE UCR_UQCRX_QCR9
Motif
Other DBs
NCBI-ProteinID: ACT62280
Position
1490690..1491487
Genome map
AA seq 265 aa AA seqDB search
MMTDLTTIFKNHKAFIAFVVAGDPNFEATVDQVVALAEAGCDLVEIGIPFSDPVADGPEI
QAADLRAFDQHITPQRVFELVVAIREKTTIPLVFLTYANIVYQFGYAAFAQQCQSLNVAG
LIIPDMPLEASGELRPTLDHYGIALIPLIAPTSDDARIAAIAQQARGFIYVVSSLGVTGT
RRHITTDLATLVAKIRHATTLPVAIGFGIHEPAQAQAMAQIADGVIVGSAVVHLIATHQP
ATAVLRDYTRRMRRALDGRTADTVD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgatgactgatttaacaacaatttttaaaaatcataaggcgtttattgcttttgtagtg
gccggtgatcctaattttgaagcgacagttgaccaagttgttgcgttagcagaagcgggt
tgtgatctcgttgagattggcattccgttctcagaccctgtggctgatggtcccgaaatt
caggccgctgatctccgtgcgtttgaccaacacatcacaccccaacgcgtttttgaattg
gtggtggcaattcgagagaagacaactattccactcgtatttttaacctatgcgaacatt
gtttatcagtttggttatgctgcctttgcccagcagtgtcaaagtttgaatgtcgcaggc
ttgattattcccgacatgccactagaagcctctggtgaacttcgaccaaccttagaccac
tatggtattgctttgattccattgattgcgccaacgagtgatgatgcacgcatcgcagcg
attgcccagcaggcgcggggcttcatttatgtcgtatcatcactaggtgtcacggggacc
cggcgacacatcacgactgatttagcaacactggtggcgaagattcgccatgcgactacg
ttacctgtcgcaattggttttggtatccatgagccagctcaggcccaggccatggcacaa
attgcggacggggtcatcgttggtagtgcagtcgtgcatttgattgcgacgcaccaacca
gcgacagcagtcttaagggactatacgcgacggatgcggcgcgcattggatggtcgcacg
gctgatacagttgactga

DBGET integrated database retrieval system