KEGG   Lactobacillus plantarum JDM1: JDM1_1399Help
Entry
JDM1_1399         CDS       T00946                                 

Gene name
adh1
Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    JDM1_1399 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_1399 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    JDM1_1399 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    JDM1_1399 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    JDM1_1399 (adh1)
   00626 Naphthalene degradation
    JDM1_1399 (adh1)
Enzymes [BR:lpj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     JDM1_1399 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1496735..1497778
Genome map
AA seq 347 aa AA seqDB search
MKSTIFEKAGLVSVQEVDKPTLQADDDVIVRIVRTCVCGSDLWSYAHGDDKAAHSINEGH
EAIGIVEAIGSAITTVKPGDFVITPFTHGCGECAACLAGFDGTCDRHPGHTNWSNGFQAE
YIRFTYGNWALVKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARCANVQKGDKVVVIGDG
AVGQCAVIAAKLRGAAQIVLMSRHEDRQQMALASGATAVVAERGDEGIAKVREILGGGAD
AALECVGTEAAIDQALGVLHNGGRVGYVGVPHYNNRPLGSTFAQNIAVAGGSASVTTYDK
QFLLKAVLDGNINPGRVFTQTYPLADINQAYQDMQNRKTIKAMITID
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaacaattttcgaaaaagctgggctagtatctgttcaggaagttgacaaacca
acattgcaagctgatgatgatgtcattgtgcgcatcgtgcggacttgtgtttgtggttcc
gatttgtggtcatatgcgcatggtgatgacaaagctgcccattcgatcaacgaaggacat
gaagctatcggaatcgttgaggcaattggctcggccattacgacggtcaagccaggcgac
tttgtcatcaccccatttacccatggctgtggtgagtgcgcggcttgtttggctggtttc
gatggtacttgtgatcggcatccgggccacacaaattggtctaatggctttcaagcagaa
tacattcgcttcacttatggtaactgggcgttagttaagattcctggtcaacctagtgac
tatacggaagggatgctcaagtcattgttgacgctggcagacgtgatgccgactggttat
cacgcggcacggtgtgcaaacgttcaaaagggcgataaagtcgtggttattggtgacggt
gccgttgggcaatgtgctgtgattgcagctaagttgcggggtgccgcgcaaatcgtcttg
atgagtcgccacgaagatcggcagcaaatggcactggcatctggcgcgaccgcggttgtc
gctgaacgtggtgacgaaggcattgcgaaggtacgtgaaatccttggtggcggcgcggat
gcggcgttggaatgtgtcggcaccgaagcggccattgaccaagctttaggtgttttgcat
aatgggggtcgcgtaggctatgtgggtgtaccacattataataaccggccacttgggtca
acctttgctcaaaatattgcggttgctggtggttccgcctccgttacgacttatgacaaa
cagttcctactcaaagcagttttggacggtaatattaatccgggccgggtatttacgcaa
acgtatccattagccgacattaatcaggcttatcaagacatgcaaaatcgaaagacaatt
aaggctatgattaccattgattaa

DBGET integrated database retrieval system