KEGG   Lactobacillus plantarum JDM1: JDM1_1454Help
Entry
JDM1_1454         CDS       T00946                                 

Gene name
galM2
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00010  Glycolysis / Gluconeogenesis
lpj00052  Galactose metabolism
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01120  Microbial metabolism in diverse environments
lpj01130  Biosynthesis of antibiotics
Module
lpj_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_1454 (galM2)
   00052 Galactose metabolism
    JDM1_1454 (galM2)
Enzymes [BR:lpj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     JDM1_1454 (galM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACT62341
Position
1546930..1547943
Genome map
AA seq 337 aa AA seqDB search
MRRTISAVPFGVYQGESVYLYTIENIHHSKLKVLSYAATWYDFEVQVDRQPHSLVLHFDN
LADYIETPYQVGKTVGRVAGRIGNATFSLNGQTYHLPPNNGQHLLHGGNHGLQTHNFRAR
FDPDGDTVTLTTTLASADDGFPGDLTVTVSYTLTADDEVQISYHGVTTADTLFNPTCHVY
FNLDGQAALINPQQLRINSTKLVHTNHEKVPTGVFYVPSPAYDFREQPTIQSQLDRLIQE
TGRTEYDDCYVLDHQDEPAGVLATTHGRLLINTDRNGLVIFTANPERTQSYRLGDYHALA
VELQTLPDAINHHGFGDVVLRAGQPRTYVNRYQYVSK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtacgatttctgcagtaccatttggtgtgtatcaaggcgagtcagtctattta
tacacgattgaaaatatccatcatagcaaactaaaagtgttgagttatgcggcaacgtgg
tatgacttcgaagtgcaggtcgaccgccagccacactcattagtgcttcactttgataac
ttggcggattatatcgagacgccttatcaagtcggcaaaacagtgggtcgagttgctggc
cgaatcggtaacgcgacgttttccttgaatgggcagacgtatcacttaccaccaaataac
ggccagcatttgctacacggtggcaatcatggcttacaaacgcataattttcgagctcgt
tttgatcctgatggcgacactgtcacattgacgacaacgctagcgagcgctgacgatggt
tttccaggcgacttgacggtaactgtaagctatacgttaacggccgatgatgaggttcaa
atcagctatcacggggtgaccactgctgatacgttattcaatccgacctgtcacgtttac
tttaatcttgatggtcaggccgcactgattaatccccagcaattacgtatcaactcgacc
aagctagttcatacgaatcacgagaaggttccgaccggcgtcttctacgtcccgtcacca
gcgtatgactttcgtgagcagccaacgattcaatcgcagctcgatcgattgatccaagaa
actggcaggacggaatacgatgattgctatgtgcttgaccaccaggatgaacccgctggc
gtgttggcaacgactcacgggcgactgctcatcaacacggatcgcaatggtttagttatc
tttaccgctaatcccgaacgaacgcagtcgtatcgtttaggggactaccatgcgctggcc
gtggaattgcaaaccttgccggatgctattaatcatcatggctttggcgatgttgttcta
cgggctggtcagccacggacgtacgtgaaccgctaccaatacgtgtcaaaatag

DBGET integrated database retrieval system