KEGG   Lactobacillus plantarum JDM1: JDM1_1596Help
Entry
JDM1_1596         CDS       T00946                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00010  Glycolysis / Gluconeogenesis
lpj00030  Pentose phosphate pathway
lpj00051  Fructose and mannose metabolism
lpj00052  Galactose metabolism
lpj00680  Methane metabolism
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01120  Microbial metabolism in diverse environments
lpj01130  Biosynthesis of antibiotics
lpj01200  Carbon metabolism
lpj01230  Biosynthesis of amino acids
lpj03018  RNA degradation
Module
lpj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_1596 (pfkA)
   00030 Pentose phosphate pathway
    JDM1_1596 (pfkA)
   00051 Fructose and mannose metabolism
    JDM1_1596 (pfkA)
   00052 Galactose metabolism
    JDM1_1596 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    JDM1_1596 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    JDM1_1596 (pfkA)
Enzymes [BR:lpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     JDM1_1596 (pfkA)
Protein phosphatases and associated proteins [BR:lpj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     JDM1_1596 (pfkA)
Messenger RNA biogenesis [BR:lpj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     JDM1_1596 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACT62483
Position
complement(1693698..1694660)
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVAGKAMAEGLEAYGINYGFAGLVAGDIHKIEAADLDGV
IQRGGTLLYSARYPEFAHEEGQLKGIEQLKRFGIDALVVIGGDGSYHGALRLTEHGYNTI
GLPGTIDNDIPYTDFTIGFDTAVNTNVQALDRIYDTAHSHDRTFVVEVMGRGAGDVALWS
GVSIGATAIVVPEVDWDMEEIANKIKHNRANGHRSNLIVLAEGVMGAQEFVEKLSEYGDF
DARGNTIAHMQRGGNPTAKDRVMASKMGAYAVELLLAGKGGLAVGIQNNQLVNHNILDLF
ESKHDVEVSLDKLNEEISFK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaaccagtggcggcgacgctcctggtatgaatgcggccgtt
cgtgcagttgctggtaaagcaatggctgaagggttggaagcatacggcatcaattacggc
tttgctggattagttgccggtgacattcacaaaatagaagcagccgacttagatggtgtg
attcaacgcggcggaactttactatactccgcacgttatccagaatttgcccatgaagaa
ggtcaattaaaagggatcgaacaattgaagcggtttgggattgatgctttagttgttatc
ggtggcgacggttcttaccatggcgcattgcgcttaacggaacacggctacaacacgatt
ggtcttccagggacgatcgataatgatattccttacacggacttcacaattggttttgac
actgctgtcaacaccaacgtgcaagctcttgaccggatttatgatacggctcatagtcat
gaccggactttcgttgtggaagttatgggtcgtggcgctggtgacgtagccttatggtcc
ggtgtttcaatcggcgcgactgctatcgtggtccccgaagttgattgggacatggaagaa
atcgccaacaagattaagcataaccgggccaatggtcatcggagcaacttgattgtgtta
gccgaaggtgtgatgggtgcccaggagtttgttgagaagttatccgaatatggtgacttt
gatgctcgtgggaataccattgctcatatgcaacgtggtgggaatccaactgctaaagac
cgtgtcatggccagcaagatgggtgcctacgctgtggaactcttgcttgccggcaagggt
ggcttagcggttgggattcaaaacaaccaattagtcaaccacaacatcttagatttattt
gaatctaagcatgacgttgaagtgtcattagataagttgaatgaagaaatttcattcaag
taa

DBGET integrated database retrieval system