KEGG   Lactobacillus plantarum JDM1: JDM1_1617Help
Entry
JDM1_1617         CDS       T00946                                 

Gene name
dapE1
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    JDM1_1617 (dapE1)
  Amino acid metabolism
   00300 Lysine biosynthesis
    JDM1_1617 (dapE1)
Enzymes [BR:lpj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     JDM1_1617 (dapE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1723423..1724568)
Genome map
AA seq 381 aa AA seqDB search
MRTIEDDAALKILADVIKIPSVNDHELTVAKYLQALLAKYDISAKIYPITGDRANLVAEI
GHGQPVLAVSGHMDVVAAGDLAAWDTDPFTLVEKSGQLFGRGVTDMKAGLVALVAAMINI
QQQGGPKHGTIRLLATMGEEVGEAGSAAFYQQGAMQDAAGLLIAEPSTVYGTAAEQKGSY
DLKLTSKGKAVHSSTPERGYNALVPLIKLLNEANDYFETIPAGEMGPVRFNIDVLNGGDQ
VNSLPDLATALVNVRTIPEYDNDQVTQKLTDLIAAYNQQGADIKMTAIMNESPIATTADN
RLVKLVQAIGKPYAGRDVVVASSPGITDASNLAKRQPADFPFAVYGPGNMTQHQVNESLP
KQMFYDFIAIYQQLFTRFLAE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacgattgaagacgatgcagcgcttaagattctagcggatgtgattaagattcca
tcagttaacgaccatgagttgacggtcgcaaaatatttgcaagccctgttggcgaagtat
gatatttcagctaagatttaccccattaccggtgatcgtgcaaatctagttgcagagatt
ggtcatgggcagcctgttttagcggtttccggtcatatggatgtggttgcggcaggtgac
ctggcggcgtgggacaccgatcctttcaccttagtagaaaaatccggtcagttatttggt
cggggcgtcacggatatgaaggctggtttagtcgcattagtcgctgcgatgatcaatatt
cagcagcaaggtggccctaaacatggcaccattcgcttgttggcgacaatgggcgaagaa
gttggtgaagctggctcagctgccttttatcaacaaggggcgatgcaagatgcagctggt
ttactgattgctgaaccttcaacggtttatggaacagcggctgagcagaaggggtcttat
gacttaaaattgacgtctaagggtaaggcggtacacagttcgacacccgaacgcggctat
aatgctttagtcccgctgattaaattactcaatgaagccaatgactattttgaaacgatt
ccggcaggcgagatgggaccggtcagatttaacattgacgtgttaaacggtggggaccaa
gtaaattcgttacccgatttagcgactgcactcgttaatgtgcggacgattccggaatac
gataatgaccaagtgacccaaaaattaacggacctgatcgcagcgtataatcagcaaggt
gctgacattaagatgaccgctatcatgaatgagtcaccaattgcaaccacggctgataat
cggttagtaaagttagtgcaggccattggcaagccctatgctggccgcgatgttgtcgtt
gcctcaagtccgggaattaccgatgcttctaatttggctaagcgtcaaccagccgatttt
ccctttgcggtttatggaccgggtaatatgacccaacatcaggtcaatgaaagtttacca
aaacagatgttttatgactttattgcaatttatcaacagctgtttacacgttttttggcc
gagtaa

DBGET integrated database retrieval system