KEGG   Lactobacillus plantarum JDM1: JDM1_1803Help
Entry
JDM1_1803         CDS       T00946                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component; dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
lpj00010  Glycolysis / Gluconeogenesis
lpj00020  Citrate cycle (TCA cycle)
lpj00620  Pyruvate metabolism
lpj01100  Metabolic pathways
lpj01110  Biosynthesis of secondary metabolites
lpj01120  Microbial metabolism in diverse environments
lpj01130  Biosynthesis of antibiotics
lpj01200  Carbon metabolism
Module
lpj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_1803 (pdhC)
   00020 Citrate cycle (TCA cycle)
    JDM1_1803 (pdhC)
   00620 Pyruvate metabolism
    JDM1_1803 (pdhC)
Enzymes [BR:lpj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     JDM1_1803 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ACT62690
Position
complement(1912541..1913857)
Genome map
AA seq 438 aa AA seqDB search
MAYEFKLPELGEGLEEGEIASWLVKPGDEVKEDDSLVEIQNDKSVEELPSPVSGKVIDIL
VPEGETAKIGDVIVTIDDGSGDAAPAAKAETPAATKTEAPASEAAETPAATSAQPTGTPA
AGNPNKRVLAMPSVRQYARDKDIDITLVTPTGAHGQITKQDIDNYTGAPAATGAKPAATP
ATTAPAASEAPAPTPVKPYVSDTPELETREKMTPIRKAISKAMVNSKHTAPHVTLFDEVE
VSALMAHRKKYKQVALDRDIHLTFLPYFVKALVAVLQQFPELNASIDDANKEIVYKHYFN
IGVATDTDRGLLVPNIKHAEGKGLFAIAKEITDNTQKAYDGKLKASEMSGGSITISNIGS
IGGGWFTPVINQPEVAILGVGRIGKEPYVNDDGEIVVGKMQKLSLSFDHRLIDGATAQRA
MNLLKQLLHDPELLLMEG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagtttaaattaccagagcttggtgaaggtcttgaagaaggcgaaattgca
tcatggctcgtaaaacctggtgatgaagtcaaagaagacgattctctagttgaaattcaa
aatgataaatcggtggaagaattaccatcgccagtaagtggtaaagttattgatatttta
gttccagaaggtgaaacggctaaaattggtgatgtgatcgtcacgattgacgatggttct
ggcgacgctgcgccagcggctaaggctgaaacaccagcggctactaagacggaagccccg
gcaagtgaagcagctgaaactcccgctgcaacatcagcacaaccgactggaaccccggct
gcgggcaatcctaataaacgggtcttggcaatgccatcagtgcgccagtacgcacgtgat
aaggacattgacatcacgttagttacgccaactggtgcccatggtcagatcacaaagcaa
gatattgacaattacacgggtgcgccagcggcaacgggtgctaaaccggcagctacgcca
gcgacaacggctccggctgcaagtgaagcaccagcaccaacaccagttaaaccatatgtt
tctgacacacctgaattagagacgcgtgaaaagatgacgccaattcggaaggcaatctct
aaggctatggtgaacagtaaacacaccgcgccacatgttactttatttgatgaagttgaa
gtgagtgcgttgatggcacaccggaagaagtacaagcaagttgctttggatcgcgacatc
catcttaccttcttaccatacttcgtgaaagctttggttgcggttttacaacaattccca
gaattgaacgcgtcgatcgatgatgcaaacaaggaaattgtttacaaacactacttcaat
attggggtagctaccgatactgaccgtggattgttagtgccaaatattaagcacgctgaa
ggtaagggcttgtttgcaattgccaaagaaattactgacaatacgcaaaaagcttacgat
ggcaagttaaaggccagtgaaatgagtggtgggtctattactattagtaatattggctca
attggtggcggctggtttaccccagttatcaaccaaccggaagttgccattttaggtgtt
gggcgtatcggtaaggaaccttacgtcaatgacgatggtgaaatcgttgttggtaagatg
cagaagttgtccttgagttttgatcaccgtctgattgatggtgcaacagcacaacgggca
atgaacttattgaagcaattgttacatgatccagaattacttttgatggaaggatga

DBGET integrated database retrieval system