KEGG   Lactobacillus plantarum JDM1: JDM1_1886Help
Entry
JDM1_1886         CDS       T00946                                 

Gene name
rbsK2
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JDM1_1886 (rbsK2)
Enzymes [BR:lpj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     JDM1_1886 (rbsK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2002479..2003399)
Genome map
AA seq 306 aa AA seqDB search
MNKVTVLGSLNVDSILRFKRFPKPGETLPLTGKSVAGGGKGANQAIAAARAGAQTTFIGK
VGTDQEGAFMVQQLTNSGVNDQYVQHSNVASTGSAFILLDSSSENRILIDGGTNQQVTAE
DVERAQPAISASTFLIAQFETPIAATIRGFELAQAAGQKTILNPAPATTTVPAELLATTD
LIVPNETETETLTGVHITDEQSMIQGAQKLQALGVANVIITVGSKGAFWMRGAEHGFVPA
YKVEAVDTTAAGDTFIGALSSVLMPDFSNLAAAVRFANRASSIAVQKLGAQPSIPTKEAI
EAAERA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtaaccgtactaggtagtttgaatgttgattcgattttgcgtttcaagcgt
tttcctaagcctggtgaaacgctaccgctgactggtaagagtgtcgctggtgggggtaaa
ggggctaaccaagccatcgcagccgcgcgcgctggtgcccaaacgacttttatcggtaaa
gttggtactgatcaggaaggggcctttatggtgcagcaattgacgaatagtggtgttaat
gaccaatatgttcaacatagcaatgtggctagtaccggctcagctttcatcttgttagat
agtagtagtgagaaccgtatcttaatcgatggtggaactaatcagcaggttacggccgaa
gatgttgaacgggcccaacccgcaattagcgctagtacttttttgattgcacagtttgaa
acgccgattgcagcaacgattcgagggtttgaattggctcaggccgctgggcaaaaaacg
attttaaacccggcaccagctacgacgacggtgcccgcagaattactagcgacgaccgac
ttaattgttcctaacgaaactgagacggaaaccttgactggcgtgcacattactgatgag
caatcgatgattcagggcgcacagaagttgcaggcgctgggcgttgctaacgtgatcatt
accgttgggagtaaaggcgctttctggatgcgcggtgctgagcacggcttcgtcccagct
tataaggttgaggctgttgacacgactgcagctggggacacctttattggtgcactcagt
tcggtcttaatgccagactttagtaatttggccgctgcggtacggtttgccaaccgggca
tcttcgatagctgttcaaaaattgggtgcgcaaccatcgattccaactaaggaagccatt
gaagcggctgagcgggcctaa

DBGET integrated database retrieval system