KEGG   Lactobacillus plantarum JDM1: JDM1_1974Help
Entry
JDM1_1974         CDS       T00946                                 

Gene name
murA2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lpj00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lpj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2098472..2099788)
Genome map
AA seq 438 aa AA seqDB search
MEEIVVHGGQRLTGNVHIEGAKNAVLPILAASLLASSGQTHLSNVPVLSDVFTMNNVLKF
LNTKIDFDEINKTIDIDASRQLSSEAPFQYVSKMRASIVVMGPLLARLGHAKVAMPGGCA
IGSRPIDLHLKGLNALGAEIERHDGYVEATANQLHGAAIYLDFPSVGATQNIMMAATLAD
GITTMENVAREPEIVDLANYLNQMGAKVTGAGTETIRIEGVKAMHGCDHSIVQDRIEAGT
FMVAAAVTQGNVLVEDAIAEHNKPLISKMREMGVTVTEEPAGIRVIGPEILKPTSVKTMP
HPGFPTDMQPQMTILQLCAQGTSLLTETVFENRFMHLDELRRMNADFKVEGRSVIMYGPT
DFNGAQVTATDLRAAAALVIAGLVSRGYTEVTNLKYLDRGYFNFHGKLAKLGAEIKRVDV
PDGTVYALNPDFANEAAE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaattgtagttcatggcggtcaacgtttgacaggaaatgtccatattgagggc
gctaaaaatgccgtgttaccaatcttagccgcaagcttgttggctagttctggtcagaca
catttatcaaatgtaccagtgttatcagacgtttttacaatgaacaacgtcttgaaattt
ttgaatactaaaattgattttgatgaaattaataaaacaattgatattgacgctagtcgt
caattatcatccgaagcaccatttcaatacgtatccaaaatgcgtgcttcaatcgtggtc
atgggaccactattagcacgattaggccatgcgaaagtcgcgatgccaggtggctgtgcg
attggttcacgaccaatcgatttacacttaaagggactgaacgcgcttggtgctgaaatc
gaacgccacgatggctatgttgaagcaaccgcgaaccagttacacggagcggccatttac
ttagattttccaagtgttggggcaacgcagaacataatgatggcggcaacacttgcagat
ggcatcacgacgatggaaaacgtcgctcgtgaacctgaaattgtggacctagcgaactat
ttgaatcagatgggcgctaaggttaccggggccggtactgaaacgatccgcattgaaggg
gttaaagcgatgcatggctgtgaccatagtatcgttcaggatcggattgaagctgggaca
ttcatggtcgctgctgcggtgactcagggaaacgtcttggttgaggatgctattgccgaa
cataataagccattgatctcgaagatgcgtgagatgggcgtcacagtaacggaagaaccg
gctggtattcgggtcattggtccagaaatcttgaagccaacctccgttaagacgatgccc
catccgggttttccaacggatatgcaaccacaaatgacaattttgcagttgtgcgcgcag
ggcactagtttattaactgaaacggtttttgagaatcgcttcatgcatcttgatgagtta
cggcgaatgaacgccgacttcaaagttgaagggcgctccgtcattatgtatggtcccact
gactttaacggggcccaggtcactgcgacggatcttcgggcagctgcagcgttagtaatc
gctggactggtcagtcggggttacactgaagtgactaatttgaagtatcttgatcggggc
tactttaacttccatggtaagctggctaaattaggtgctgagattaaacgagttgatgtt
cccgatggcaccgtttatgcgttgaatcctgattttgcgaacgaagctgcggaataa

DBGET integrated database retrieval system