KEGG   Lactobacillus plantarum JDM1: JDM1_2212Help
Entry
JDM1_2212         CDS       T00946                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    JDM1_2212 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JDM1_2212 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    JDM1_2212 (thrC)
Enzymes [BR:lpj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     JDM1_2212 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2359570..2361063
Genome map
AA seq 497 aa AA seqDB search
MKTLYRSTRETASHTMTSSQAVLQGLTPDGGLFVPVTLPTANFDFDQLATMSYQEVAYEV
LKLFFTDYTADELHACIDAAYGDQFDDPQIAPVTKHGQQYYLELFHGPTIAFKDLALQIL
PHLMTTAVKKNHLQAEVVILAATSGDTGKAAMAGFANVDQTRIIVFYPKDGVSAIQKQQM
VTQTGANTSVVAINGNFDEAQTTVKKLLNDHQLHAELATHQFQFSSANSINIGRLFPQVA
YYVYTYAQLIKQGQIKNGDEINFSVPTGNFGDILAGYYAKQLGTPIHKLICASNRNNVLT
DFFNTGTYDKNREFFLTSSPSMDILVSSNLERLLFYLTGSDATATAKLMTDLQTTGRYTI
TPAMRANLADFWAGFVTESQDQAEIHHLNHAHHYTIDPHTAVASAVAKQYQAATRDQRPM
VVVSTASPYKFPQAVLTAITGELSAVDGLAAVDQLHELIQTPIPATVTALRTAPVRHKRV
ADVDDMGTTIKTILNLN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactttatcgcagtacccgcgaaactgcaagtcacaccatgacgtcatcacaa
gccgtacttcaaggcctgacgccggatggtggtctctttgtgcccgtaacgctaccgacc
gctaattttgacttcgaccagctcgccacgatgagctaccaagaagttgcttacgaggtc
cttaaactcttcttcacggattataccgctgatgaattacacgcctgcattgacgcggct
tatggtgatcagtttgatgacccccaaattgcgccggtcaccaagcatggtcagcagtat
taccttgaactttttcatggaccgaccattgcattcaaagacttggcccttcaaatccta
ccgcatttgatgacaacggcagttaaaaagaaccatttacaagccgaagtcgttatttta
gcggccacctcgggcgatactggtaaagctgccatggccgggtttgccaatgttgatcag
actcgcatcatcgtcttctatccaaaagatggtgtcagcgcaatccaaaaacagcagatg
gtgacccaaaccggagccaatactagtgttgttgcgatcaacggtaacttcgatgaggcc
caaacaacggttaaaaaactgttaaacgaccaccaactacacgcggaattagccacccac
cagttccaattctcaagcgctaattccatcaatattggtcgtttattcccacaagtggcc
tattatgtctacacctacgctcaacttatcaagcaggggcaaatcaagaacggtgatgag
attaactttagtgttccaactgggaactttggggatattttagctggctactatgccaaa
caactgggcacgcccattcataaactgatctgtgcttccaatcgcaataacgttctcacc
gatttctttaataccgggacttatgacaaaaaccgtgaattcttcttgacgagttcaccg
tccatggacatcttagtctcaagtaacttggaacggctcctcttctacttgacaggatca
gacgccacggcgactgctaaactaatgactgatttgcaaacgaccggccgttatacgatt
acaccggcaatgcgtgccaacttagctgatttttgggccggcttcgtgactgaaagccaa
gatcaagctgaaattcatcacctgaaccatgcccatcactacacaatcgatccacatacg
gccgtggcctcggcggttgccaaacagtatcaagccgcaaccagagatcagcggcccatg
gtggttgtttcaaccgctagtccgtataaattcccacaggccgtcctaacggcaattact
ggtgagcttagtgcggtagatggcctagccgcagttgatcagttacatgagttgattcaa
acgcccattccagcaacggtcacagccctccgtactgcgcccgtgcgccataagcgggtt
gcggatgttgatgatatgggaacgaccattaaaacaattttaaatcttaactag

DBGET integrated database retrieval system