KEGG   Lactobacillus plantarum JDM1: JDM1_2229Help
Entry
JDM1_2229         CDS       T00946                                 

Gene name
pbg4
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lpj00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2377229..2378671)
Genome map
AA seq 480 aa AA seqDB search
MATTSGLRSDFLWGGAVAAHQLEGGWQAGGKGVSVADVMTAGANGVPREITDGVIAGKNY
PNHEGIDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPNGDEEEPNEAGLKFYDDMFDTC
RQYGIEPVITLAHFEMPYHLVKEYGGWRSRKVIDFFVHYAETVFKRYKNKVKYWMTFNEI
NNQTTYTNQFLMATDSGLVLKPDDPDAEALMYQAAHYEVVASALAVKIGHAINPDFQIGN
MINMTPIYPATAKPQDIMQAEKAMQRRYWFADVQSWGYYPNNMEAYFKQTGFRPDITAED
RQVLKEGTVDYIGFSYYNSNTVAAQDDNPSYHFVGTEAVDNPYLKTSEWDWPIDPEGLRY
SLNWLQDRYHKPMMIVENGLGARDKVEADGSIHDPYRIDYLRAHISEMIKAVTEDGVDLI
GYTPWGCIDLVSAGTGQMSKRYGFIYVDKDDEGNGTLERSKKDSFYWYQKVIRTNGADLK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaacgagtggtttacgatctgatttcttatggggtggggcggtcgcagcccat
caactagaaggcggctggcaagctggtggcaaaggggtcagtgtggctgatgtcatgact
gccggtgccaacggtgttcctcgtgaaatcacggatggtgtgattgcgggtaagaattac
ccgaaccatgaaggcatcgacttttatggtcactataaggaagatatcaagctatttgct
gagatgggcttcaagtgttttcggacatcgatcgcctggacgcggatttttccaaatggt
gatgaagaagaacccaatgaagcgggtttgaagttctatgatgatatgttcgatacttgc
cggcaatatggtatcgaaccagtgatcacgctggcccactttgaaatgccgtaccactta
gttaaggaatatggtggctggcgttcgcggaaagtcattgactttttcgtgcactacgct
gaaacggtcttcaaacgctataagaacaaggttaagtactggatgaccttcaacgaaatt
aataatcagacgacttatacgaaccaattcctgatggcgacggattctggtttagtgttg
aagcccgatgatcctgacgctgaagctttgatgtatcaagctgctcattatgaagtcgtt
gccagtgcgctagccgttaagattggccatgccattaatcccgacttccagattggcaat
atgatcaacatgacaccgatttatcctgcaactgctaagccacaagatatcatgcaagct
gaaaaggctatgcagcggcgttattggtttgcagacgtacagtcatggggctattatcca
aataatatggaagcttacttcaaacagactggtttccgccctgatatcacggccgaagac
cgccaagtcttgaaggaaggcaccgttgattatattggctttagttactataattccaac
acggtcgccgctcaggatgataacccaagctaccactttgtcgggaccgaagccgttgat
aatccatacttgaagacgagcgaatgggactggccaatcgatccagaaggtttgcggtat
tctttgaattggttgcaagaccgctatcacaagccaatgatgattgttgagaatgggttg
ggtgcccgcgacaaagtcgaagccgatggtagtattcatgatccttaccggattgactat
ttacgcgctcatatcagtgaaatgatcaaggccgtcaccgaagatggggtcgacttgatt
ggctatacgccgtggggttgtatcgatttggtctcagctggaactggtcagatgtcgaaa
cgttacggttttatctacgtcgacaaggacgatgaaggtaacgggacactagagcgctcg
aagaaggattcgttctactggtatcaaaaagtgattcggacgaatggggccgatttgaag
tag

DBGET integrated database retrieval system