KEGG   Lactobacillus plantarum JDM1: JDM1_2304Help
Entry
JDM1_2304         CDS       T00946                                 

Gene name
pgm8
Definition
(GenBank) phosphoglycerate mutase (putative)
Organism
lpj  Lactobacillus plantarum JDM1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2465030..2465668)
Genome map
AA seq 212 aa AA seqDB search
MKSITLHLVVAGATYFNQLDRFQGWSGTPLTATGEQATAKVAQQLASTTFDTAFASDTSR
AIQTARIILDSRAQPVKLRTVVALRAPFYGGFEGTERAAVWSGFATKLGYQSVAAFAADQ
TPSELQTLLHDHDADGLAESGQEFWDRYQKGLQQVMAATPDHGQVLLIVDGATLRMMHYV
ATGRAATRQELAPSVVTTMVYTGDKVTVPVTE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaatcaccttacacttagtcgttgctggagcaacgtactttaatcaacttgac
cggttccagggttggagcggcacgccgttgacggcgactggcgaacaggcgacggccaag
gttgcgcagcagttggcgtcgacaacgtttgataccgccttcgctagtgatacgagtcgg
gcgattcagactgcgcgcattatcttagactcacgagcacaacccgttaagttgcgaacg
gtagtcgcgttacgtgcgccattctatggcggctttgaaggaactgaacgcgcggcggtt
tggtcaggatttgcgactaagctaggttatcagagcgtggccgcttttgccgcggatcag
acccccagtgagctacagacattgttgcacgatcacgatgcggatggattggcggaaagt
ggtcaggagttctgggatcgctatcaaaaggggttacaacaggttatggcggcaacgcct
gatcatggtcaggtcttgttgattgtggacggcgcaacgttgcgaatgatgcattacgtc
gcaactggtcgtgcggcaacgagacaggaattggcaccaagtgtggtgacaacgatggtt
tacactggggataaggtgactgtaccggttacggaataa

DBGET integrated database retrieval system