KEGG   Lactobacillus plantarum JDM1: JDM1_2535Help
Entry
JDM1_2535         CDS       T00946                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JDM1_2535 (gpmA)
   01230 Biosynthesis of amino acids
    JDM1_2535 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_2535 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    JDM1_2535 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JDM1_2535 (gpmA)
Enzymes [BR:lpj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     JDM1_2535 (gpmA)
Exosome [BR:lpj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   JDM1_2535 (gpmA)
  Exosomal proteins of melanoma cells
   JDM1_2535 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2729462..2730154)
Genome map
AA seq 230 aa AA seqDB search
MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEEAKAAGQKVKEAGLEFDYAFTSVLTR
AIKTLHYVLEESDQLWIPETKTWRLNERHYGALQGLNKKETAEKYGDDQVHIWRRSYDVL
PPLLSADDEGSAVNDRRYADLDPNIVPGGENLKVTLERVMPFWEDQIAPKLLDGKNVIIA
AHGNSLRALSKYIEQISDDDIMDLEMATGEPVVYDFDEKLKVLGKEKLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagtattgattcgtcacggtcaaagtgaatggaacttatctaaccaattt
actggttgggttgacgttgatttaagcgaaaagggtgttgaagaagctaaggctgctggt
caaaaagttaaagaagcaggcttagaattcgattacgcctttacttcagttttgactcgt
gccatcaagactttgcactatgtgcttgaagaatccgaccaactctggattccagaaacc
aagacttggcgtttaaacgaacgtcattatggtgcattacaaggattgaacaagaaggaa
accgctgaaaaatacggtgacgaccaagttcatatctggcgtcgttcttatgatgtttta
cctccattattgagtgccgatgatgaaggttcagccgttaacgatcgtcgttacgctgac
ttagaccctaacatcgtccctggtggcgaaaacttgaaggttaccttggaacgcgttatg
cctttctgggaagaccaaatcgcacctaagttattagacggcaagaatgtaatcattgct
gcccacggtaactcattacgtgccttaagcaagtacatcgaacaaatcagtgatgatgat
atcatggaccttgaaatggctactggcgaaccagttgtctatgactttgatgaaaagtta
aaggttcttggtaaggaaaagttaggcaaataa

DBGET integrated database retrieval system