KEGG   Lactobacillus plantarum JDM1: JDM1_2762Help
Entry
JDM1_2762         CDS       T00946                                 

Gene name
lacA
Definition
beta-galactosidase I
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    JDM1_2762 (lacA)
Enzymes [BR:lpj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     JDM1_2762 (lacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2970487..2972538)
Genome map
AA seq 683 aa AA seqDB search
MSNPLKTTEFLHGGDYNPDQWLDQPEVIKQDFKAFKAAKLNTVTLGIFAWDKLEPAEGQY
DFSWLDQIFDRAEAQGTKIILSTPSGARPRWLAEKYPEVLRVNEHGQRNQFGERHNHCYT
SPVYREKVQMINQKLAERYGQRPSLLLWHISNEYGGACYCDLCQQAFRHWVQKKYQTLAN
LNHAYCGAFWSHDYTSWDQVQAPSPLGDTNVMGLNLDWHRFVTDRTIDFFDNEIKPLRAL
TPNIPVTANFMGGNPSESHVFYDLDYQKFAKHVDIVSWDSYPNWSNGYESTAHLAMKTAL
MNDVMRSLKHDNYLIMESTPSQVNWHPYNRAKRPGMHEMGSLQQVAHGADSVLYFQLHQS
LGASEMFHGAVIANHRGSNTRAFKDVQKVGQDLQSLQAAHGTTRTAAKVAIVFDYDNMWG
LDDARNYANETKKYWRTIQEHYQYFWKHDIPVEIIATTDDLTAYDLVIDPMHFMMSAQFA
TKLKAYVQQGGHLIGTYITGVVDHDFLAYQGDGLADLEATYGIKVQENDTLYPQQHNALT
AYHQAYQVNDYCDVVETTTAQVLGTYQKDFYAGTPAVTVNQLGQGAAYYLAARTDTDFLD
AFYERLATSLALKPALPVIKANAKVSIQVRENATTRYYFVINFSHRPTTVTLEVPLQRVF
ENQVVSGKQDLASYGVQVYMMNK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatccattaaagacaacagaatttttgcatggtggtgattataatccagaccag
tggcttgaccaacccgaggtgattaagcaggattttaaagcgtttaaggctgctaagtta
aatacggtgacattgggaatctttgcttgggacaagttagagcctgctgaggggcagtat
gattttagctggttagatcaaattttcgatcgtgccgaagcccaagggactaagatcatt
ttgtcgacgccaagcggggctcgtccacgctggttagctgagaaatatccagaagtgtta
cgtgtcaatgaacacggacagcgaaatcaattcggcgagcgacataatcactgttacaca
tcgccagtttaccgagaaaaggttcagatgattaaccagaagttggcggaacgttacggt
caacgaccaagcttgctgctatggcatatctctaatgaatatggcggtgcttgttactgt
gatttgtgccagcaagccttccgtcattgggttcaaaaaaagtatcaaacgttagccaat
ttgaaccatgcttactgtggtgctttttggagtcacgattatacaagttgggatcaggtt
caggcaccgtcgccgctgggtgatacgaatgtaatgggacttaacctggattggcatcgt
tttgtaacagaccggacgattgacttttttgataatgaaattaaaccgttacgagcgctg
acacctaatatccctgtgacagccaattttatgggtggcaacccatcagaatcacacgtc
ttttatgatttagattatcagaagtttgcgaagcatgtcgatattgtgagttgggattca
tatcctaattggagtaatggttacgaaagtacggcccacttggccatgaaaactgctttg
atgaatgacgtgatgcggagcctcaagcatgataactacttgattatggaaagtacaccg
tcacaggttaattggcacccatataatcgtgccaaacgaccaggcatgcacgaaatgggg
agcttgcaacaggttgcccatggcgccgactcagttttgtatttccaactacatcaatca
ttaggagcttctgaaatgtttcatggcgccgtcattgccaaccatcgtggctcaaatacg
cgggcatttaaggacgttcaaaaagttggtcaggacttacaaagcttacaggccgcgcat
ggaacgaccagaactgcagctaaagtcgctattgtttttgattatgacaacatgtggggg
ttagatgatgcccgcaactacgctaacgaaactaaaaagtattggcgcacgattcaagaa
cattaccagtatttctggaaacatgatattccagttgaaattattgcgactactgatgat
ttgacggcctatgatttggtgattgatccgatgcacttcatgatgagcgcccagtttgcg
actaagcttaaagcatatgtgcaacagggcggccatctgatcggcacctatattacgggc
gtcgttgatcatgacttcttagcctatcaaggtgatgggttagctgacttagaagcaact
tacggaattaaagttcaggaaaatgatacattatatccgcaacaacataatgcactgact
gcttatcaccaagcgtatcaagtgaatgattattgtgatgtagttgagacgacaacggca
caagtcctcggcacgtatcaaaaagacttttatgctggaacgccggctgtaacggtcaat
caattgggccagggagcggcgtattatttggctgcgcggaccgatactgacttcttggat
gctttctatgaacggcttgccacaagtttggcacttaaaccggccttgccagtgatcaaa
gcgaatgccaaggtaagtattcaagttagagagaatgcgacgacgcgctattacttcgtg
atcaattttagtcatcgaccaacgacggtgacgcttgaagtgccattacagcgggtattt
gagaatcaagtggtcagtggtaagcaagacctagccagctatggtgttcaagtctatatg
atgaataaataa

DBGET integrated database retrieval system