KEGG   Lactobacillus plantarum JDM1: JDM1_2802Help
Entry
JDM1_2802         CDS       T00946                                 

Gene name
pbg8
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JDM1_2802 (pbg8)
Enzymes [BR:lpj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     JDM1_2802 (pbg8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3019820..3021280)
Genome map
AA seq 486 aa AA seqDB search
MYKPTYPKTFPKDFLWGGATAANQVEGAWNEAGKGLTTAEVVKKTTDRKHMSMDDVTISS
IQTALDDQTDTMYPKRRGVDFYHHYKEDIKLFAEMGFKVYRFSIAWSRLFPKGDELKPNS
DGLAFYDRVIDELRRYHIQPLVTLSHYEMPIGLTLKQNGWASRATIADFNRFTEVVFKHF
KGRVPYYLTFNEINTGTWGFHATGAVDTENSAHDQMQLRYQALHHQFIASALATKQLHAI
DPDAKIGSMLARMQTYPATPNPADVQAAQVEDDKNLFFTDVQARGEYPEFMNRFFAENDI
QLQMAPDDQTILAKYPVDFISFSYYMTTVTQADAPEQVNGNMATGGRNPYLEESDWGWQI
DPVGLRVTLNEMWDRYRKPLFVVENGLGALDQLTTDQQVHDTYRIDYLRKHIAQMKAAVQ
DGVQLMGYTMWGPIDLISFSTSEMSKRYGFIYVDQDDAGKGSLKRYKKDSFYWYQKVIKS
NGEDLA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaccaacttatcctaaaacgttccctaaagactttttgtggggcggagcgaca
gcagctaatcaagttgaaggtgcctggaatgaagcaggtaaaggcctgacaacggcagaa
gtagtgaaaaaaacgacggatcgcaagcatatgtcaatggatgatgtaacgatatcttca
attcaaacggcgctagatgatcaaactgatacaatgtatcctaagcgtcgaggtgttgat
ttttatcatcattacaaagaagatatcaaactatttgctgagatgggatttaaagtttat
cgtttctctattgcttggtcgcgattatttccaaaaggtgatgaactcaagccaaattca
gatggacttgctttctatgatcgagtcattgatgaattgcgacgctatcacattcaacca
ttagttacactgtcacattatgaaatgcccattggattaacgcttaagcaaaatgggtgg
gccagccgggcaaccattgccgattttaatcggtttactgaagtcgtttttaaacatttt
aaaggtcgcgttccgtattatttaacttttaatgaaattaataccggaacttgggggttt
catgccactggagctgttgatactgagaattcggcgcatgatcagatgcagttacgttac
caagcgctgcaccatcaatttatcgctagtgcactggctaccaaacaattacatgctatt
gacccggatgctaagattgggtcaatgctggcaagaatgcaaacttacccagccacacct
aatcctgcagatgttcaggctgctcaagtggaagacgataagaacttatttttcacggat
gttcaagctcggggggaatatccagaattcatgaaccgtttttttgcagagaatgatatt
caactgcaaatggcaccagatgatcagacgattttagcgaagtatccggttgactttatt
agttttagttactatatgacaacagtaactcaagctgatgcgcctgaacaagtgaacggt
aatatggctactggtggtcgtaatccttaccttgaggaatccgattggggttggcaaatt
gatccggtggggttgcgagtgacactgaatgagatgtgggatcgctatcgtaagccatta
tttgttgttgaaaatgggctaggcgctctagatcaattaacaactgatcaacaagtgcat
gatacgtatcggattgactatttacgtaaacatattgcgcaaatgaaagctgcagttcag
gatggcgtacaactaatgggctatacgatgtgggggccaatcgatttgattagtttttct
acctcagagatgtccaagcgatatggttttatttatgttgaccaggatgatgctggtaaa
ggaagtctgaaacgttataagaaagattcattttactggtaccagaaggtcattaaatct
aacggtgaagatctagcttaa

DBGET integrated database retrieval system