KEGG   Lactobacillus plantarum JDM1: JDM1_2836Help
Entry
JDM1_2836         CDS       T00946                                 

Gene name
xpk2
Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lpj00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3063271..3065682
Genome map
AA seq 803 aa AA seqDB search
MQRSCKIMSEAIKSKTVDYSSDEYLKRVDEYWRAANYISVGQLYLLNNPLLREPLKATDV
KVHPIGHWGTIASQNFIYAHLNRAINKYGLNMFYIEGPGHGGQVMVSNSYLDGTYTETYP
KITQDKAGMKRLFKQFSFPGGVASHADPKTPGSIHEGGELGYSILHGAGAVLDNPGLIAA
TVVGDGESETGPLATSWQVNKFLNPITDGTVLPILNLNGFKISNPTVLSRESHEELEDYF
KGLGWDPHFVEGTDPAKMHKIMAEELDKVIEEIHAIRKNAKDNNDESRPKWPMIVFRAPK
GWTGPKSWDGEPIEGSFRAHQIPIPVDRNHMEHADKLVDWLKSYKPEELFDENGTLKPEI
AAIIPEGQARMAANPVTNGGKLTKDLITPNIDDYALDNKDHGKEDGSDMTELGKYIRDLI
ELNKDNKNFRGWGPDETLSNKLGAAFEDTKRQWMEPIHEPNDALLAPQGRIIDSMLSEHM
DEGMLEAYNLTGRYGFFASYESFLRVVDSMLTQHFKWLRNSHEETPWRADVPSLNVIASS
TAFQQDHNGYSHQDPGIISHLAEKKTEYVRAYLPGDANTLIATFDKAIQSKQLINLIIAS
KHPRPQWFTMDEAKRLVRDGLGVVDWASTDHGEEPDVVFATAGSEPTTESLAAVSILHAR
FPEMKIRFINVVDLLKLKKDDPRGLSDAEFDAFFTKDKPVIFAYHAYDDLVKTIFFDRHN
HNLHVHGYREEGDITTPFDMRVRNELDRFHLVKAALLSTPAYAEKGAHVIQEMNSILDKH
HDYIRAEGTDIPEVENWKWTALK
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaggagttgcaaaataatgagtgaagcaattaaatccaaaacagttgattactct
tctgatgaatatctaaaacgcgttgatgaatattggcgtgctgctaactacatctcagtt
ggtcaactctatctactaaataacccgttacttcgggaaccactaaaggcgaccgacgtg
aaagttcatccaatcggccattggggcacgattgctagtcaaaactttatttatgcccat
ttaaaccgggcaatcaataagtatggcttgaacatgttctacattgaaggccctggtcat
ggtggtcaagtaatggtttctaactcctacttagatggcacctatacggaaacgtatcct
aaaatcacccaagacaaagctgggatgaaacgcttattcaagcaattctcattcccaggc
ggggttgcttcccatgccgatcctaagacgcctggttcgatccatgaaggtggcgaactt
ggctactcaatcctgcatggtgctggtgcagtattagataatccaggtttaattgccgct
accgttgttggtgatggtgaatctgaaactggaccattggcaacttcttggcaagttaac
aagttccttaacccaattacagacgggacagtcttaccaatcttgaacttaaacggcttc
aagatttctaatccaacagttctttcacgtgaatcacatgaagaacttgaagactacttt
aaaggtctaggctgggatccacactttgttgaaggtacagaccctgccaagatgcacaaa
atcatggctgaagaattggataaagtcattgaagaaatccacgcaattcgtaagaacgcc
aaggataacaatgatgaatctcgtcctaagtggccaatgattgttttccgggcacctaag
ggctggaccggtcctaagagttgggacggcgaaccaattgaaggatcgttccgggctcac
caaattccaattcctgtcgatcgcaatcacatggaacacgccgacaaattagttgactgg
ctcaaatcatacaaaccagaagaattatttgatgaaaatggtactttaaaaccagaaatt
gccgcaatcatccctgaaggccaagctcgtatggctgctaaccccgtcactaacggcggt
aagttaactaaagacttaattacaccaaatatcgatgattatgctttggacaacaaggat
cacggtaaggaagacggttcagacatgactgaacttggtaagtatatccgtgatttaatt
gagttgaacaaagacaacaagaacttccgtggctggggtcctgacgaaaccttatctaac
aaactaggcgctgcttttgaagataccaaacgtcagtggatggaaccaatccacgaacct
aatgatgctttgttagcacctcaaggccggattattgactccatgttgtcagaacacatg
gatgaagggatgttggaagcttacaatttaaccggacgttacggtttcttcgcaagttat
gaatcattcctgcgcgttgtggattcaatgttaacccaacacttcaagtggttacggaat
tctcacgaagaaaccccttggcgggctgatgtaccttcactgaatgtgattgcatcatca
acagccttccaacaagatcacaatggttactctcaccaagatccaggtatcatttcacac
ttggctgaaaagaagaccgaatacgttcgtgcctatcttccaggtgatgccaatactttg
attgcaacctttgataaggctatccaaagcaaacaattgattaatttaatcattgccagc
aagcaccctcgtccacaatggttcacaatggacgaagctaagcgcttagttcgtgatggc
cttggtgttgttgattgggcaagcactgatcatggtgaagaacccgacgttgtcttcgca
actgccggctctgaaccaacgactgaaagcttagctgccgtatcaatcttgcatgcacgc
ttccctgaaatgaagattcgcttcattaacgttgttgatcttctgaagctgaagaaagac
gaccctcgtggtttatcagatgctgaatttgatgctttcttcactaaggacaaaccagtt
atctttgcttatcatgcatacgacgacttagtaaagaccatcttcttcgatcgccataac
cataacttacacgttcatggttaccgcgaagaaggcgacattacaacgccattcgacatg
cgtgttcgcaacgaactcgatcgtttccacttagtcaaagctgccttattatcaacgcca
gcttatgccgaaaaaggtgcccatgtcattcaagagatgaacagcattttagacaagcat
catgactatatccgtgctgaaggtaccgatattccagaagttgaaaactggaaatggact
gcattgaagtag

DBGET integrated database retrieval system