KEGG   Lactobacillus plantarum JDM1: JDM1_2884Help
Entry
JDM1_2884         CDS       T00946                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lpj  Lactobacillus plantarum JDM1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpj00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    JDM1_2884
Enzymes [BR:lpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     JDM1_2884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3113248..3113970
Genome map
AA seq 240 aa AA seqDB search
MTEAYIFEAERCDLAMVAREMFNRKNTNVAGGNISVKVTAPRDINYGSVHVKKDHQYLIM
TPTFMSEAWFGKLSGAQILVVDLESGQQIDGVGRLTREINMHIGAYEANPGIKVVYHSHA
EESMFWATIGQDMPNVTEITAVNQTLGKIKCLPYKEACSQELADQVHTSLLSLGDDALEN
IFLLNSHGVLITCTDLHEATRILETVEWNAKIAYQETIFKSLGLVKQYQSCGKDTDAFLD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcctatattttcgaagcagaacggtgtgacttagccatggttgctagagaa
atgttcaaccggaagaacactaatgttgctggtggtaatattagtgtcaaggttaccgca
ccacgggatattaattacggatcagttcatgttaaaaaagatcatcagtatttgatcatg
acacccacttttatgtccgaagcttggtttggtaaattatccggggcacaaattctcgtc
gtagatctggaatctggacaacaaattgacggtgtaggtcgcctaactcgtgaaattaac
atgcatatcggcgcctatgaagccaatccgggtatcaaggttgtttaccattcacatgcc
gaagaatcaatgttttgggcaactattggacaagatatgccaaacgttactgagatcact
gccgtcaatcaaactttaggcaaaatcaaatgtttgccctataaagaagcttgttctcaa
gaactagcggaccaggtgcatacaagcctattatcacttggtgatgatgcattggagaac
atttttcttctgaacagtcatggcgttttaattacttgtaccgacctacatgaagcaacc
cgcattctagaaaccgttgaatggaatgctaaaattgcttatcaagaaactattttcaag
tctcttgggctagttaagcagtaccaatcctgtggaaaggatacagacgcttttctggat
tag

DBGET integrated database retrieval system