KEGG   Lactobacillus plantarum WCFS1: lp_0016Help
Entry
lp_0016           CDS       T00115                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lp_0016 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    lp_0016 (proB)
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     lp_0016 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16638..17435
Genome map
AA seq 265 aa AA seqDB search
MKVIRKLKAKRVVIKVGTSTLVYPDGSINLRAIDQLAFVISAMRHRGREVVLVSSGAIGV
GLNYMGLKQRPKAIPEQQAIAAIGQTELISIYKERFAIYEQKIGQLLLTRDIFVYPKSHH
NVLNTFEALLKQNVVPIVNENDTVAVDELDHETKFGDNDQLSAIVATNIGADLLIMLSDI
DGFYDGNPNADARAQLLGHIEKVDQHTYKLAGGSGSRFGTGGMVTKLKAAERMIDANGQM
ILANGADPTIIFQILAGEPVGTLFG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtgatacgaaaactaaaggctaaacgagtcgtgattaaagtcgggacaagcacg
ctagtttatccagatggatcgatcaacttacgggcaatcgatcaattagcctttgtcatt
agcgcaatgcgacaccgtgggcgtgaagttgtcttggtttcgtcaggggctattggtgtt
ggcttgaattatatgggactcaagcaacgtccaaaagcaattcctgaacaacaggcgatt
gcggcgattgggcaaactgaattgatttcgatttacaaagaacgtttcgccatttatgaa
caaaaaattggccagttgttattaacacgtgatatctttgtttatcctaagagtcaccat
aatgtgttgaatacatttgaggcgctattaaaacaaaacgtggtcccaattgttaatgaa
aatgatacggtcgcggtcgatgaattggatcatgaaacaaagttcggtgataacgatcaa
ctatccgcaatcgtggccacgaatatcggggcggatttgttaatcatgctatccgacatc
gatggcttttatgatggtaatcccaatgcggatgcccgagcccagttattagggcacatt
gagaaggttgatcaacatacttataagctagctggcggtagtggcagtcggtttggtact
ggtgggatggtcactaagctaaaagcggcagaacggatgatcgatgcgaatggtcaaatg
attttagccaatggtgcggatcccacaattatttttcaaattttagcaggcgaaccagtc
ggaacgctattcggttaa

DBGET integrated database retrieval system