KEGG   Lactobacillus plantarum WCFS1: lp_0016Help
Entry
lp_0016           CDS       T00115                                 

Gene name
proB
Definition
(RefSeq) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00330  Arginine and proline metabolism
lpl00332  Carbapenem biosynthesis
lpl01100  Metabolic pathways
lpl01130  Biosynthesis of antibiotics
lpl01230  Biosynthesis of amino acids
Module
lpl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    lp_0016 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    lp_0016 (proB)
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     lp_0016 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-GeneID: 1061284
NCBI-ProteinID: YP_004888107
UniProt: Q890J5
Position
16638..17435
Genome map
AA seq 265 aa AA seqDB search
MKVIRKLKAKRVVIKVGTSTLVYPDGSINLRAIDQLAFVISAMRHRGREVVLVSSGAIGV
GLNYMGLKQRPKAIPEQQAIAAIGQTELISIYKERFAIYEQKIGQLLLTRDIFVYPKSHH
NVLNTFEALLKQNVVPIVNENDTVAVDELDHETKFGDNDQLSAIVATNIGADLLIMLSDI
DGFYDGNPNADARAQLLGHIEKVDQHTYKLAGGSGSRFGTGGMVTKLKAAERMIDANGQM
ILANGADPTIIFQILAGEPVGTLFG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtgatacgaaaactaaaggctaaacgagtcgtgattaaagtcgggacaagcacg
ctagtttatccagatggatcgatcaacttacgggcaatcgatcaattagcctttgtcatt
agcgcaatgcgacaccgtgggcgtgaagttgtcttggtttcgtcaggggctattggtgtt
ggcttgaattatatgggactcaagcaacgtccaaaagcaattcctgaacaacaggcgatt
gcggcgattgggcaaactgaattgatttcgatttacaaagaacgtttcgccatttatgaa
caaaaaattggccagttgttattaacacgtgatatctttgtttatcctaagagtcaccat
aatgtgttgaatacatttgaggcgctattaaaacaaaacgtggtcccaattgttaatgaa
aatgatacggtcgcggtcgatgaattggatcatgaaacaaagttcggtgataacgatcaa
ctatccgcaatcgtggccacgaatatcggggcggatttgttaatcatgctatccgacatc
gatggcttttatgatggtaatcccaatgcggatgcccgagcccagttattagggcacatt
gagaaggttgatcaacatacttataagctagctggcggtagtggcagtcggtttggtact
ggtgggatggtcactaagctaaaagcggcagaacggatgatcgatgcgaatggtcaaatg
attttagccaatggtgcggatcccacaattatttttcaaattttagcaggcgaaccagtc
ggaacgctattcggttaa

DBGET integrated database retrieval system