KEGG   Lactobacillus plantarum WCFS1: lp_0020Help
Entry
lp_0020           CDS       T00115                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lpl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21099..23003
Genome map
AA seq 634 aa AA seqDB search
MVKQTTEMNDASYLFNTGAGFNSQDYLGCHLAASGRAVFRVWAPHAKAVGVVGDFNDWQP
SALKLLGATGIWQGQVPNVHAGQLYKFQITTPTGQVQLKIDPFAQQFERKPGDAAVVVEP
MTMRWHDSLWLARRKKSRAANRPINIYEVHLGSWRRHLDGSYYTYAELAAELIPYVKQRG
YTHIELMPVMEHLLDASWGYQQLGYFAPTSRFGKRDSFLSFVDQCHQANIGVFVDWVPGH
FIRNYDALYQYDGTPTFEYADPERANNRRWGAWNFDLGKTQVQSFLISSAEYWLDQCHLD
GLRVDAVSNMLYCDYDEGREGQVNQYGDNRNLEGIAFLQKLNTTVLTHHPDILMIAEESS
AYPQVTGSVANGGLGFNYKWNMGWMHDTLDFFMMDPLYRHDHFNLLTFAFVYMFDERFIL
PFSHDEVVHGKKSLMHKMSGDRYNQFANLRTMLTYMAAFPGKQLNFMGSEWGQFLEWRDW
SALEWVDLKDDLNHRMQQFTTQLNAVYRHNRPLWEQDHDPAGIIYTHTDDPDSSTMGFIR
QAKRKYSFVVAAFNFVPVERQDYRIGVPYRGRYELLLNTEAQAFGGTWTKLETTFTAVDK
PYRGQPASFTVTLPAMGALLIRPVKVIGGVKHAR
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
ttggttaaacaaactacggaaatgaatgatgcaagttacttatttaataccggcgcagga
tttaatagtcaggattacttaggctgtcatttggccgcatctggtcgggcggtatttcgc
gtctgggcgccgcatgctaaggcggtcggggttgttggcgattttaatgactggcaacca
agcgcactaaagttattaggggcgactgggatttggcaaggacaagttccgaacgttcat
gcgggtcagttatacaagtttcagatcacaacaccaactggccaagtgcaactaaagatt
gacccgtttgcacaacagttcgaacgaaaaccgggggatgcggccgtagttgttgagccg
atgacgatgcgttggcacgatagtttgtggctagctcgccggaagaagtcgcgcgctgcc
aatcggccaattaacatttatgaggtgcacttaggttcgtggcgccgtcatcttgatggt
agctactacacttatgcggaattagccgctgaactgattccctatgtaaaacaacggggc
tatacccacattgaattaatgcccgtgatggaacatttattagatgcgtcttggggttat
cagcaattagggtattttgcgccaaccagtcgttttggcaagcgtgacagttttctcagc
tttgttgaccagtgtcaccaagcgaatatcggggtattcgttgattgggtaccgggtcac
tttattcgcaattatgatgcgttgtaccagtatgatggtacgccgacatttgaatacgct
gatcctgagcgcgcgaataaccgtcgttggggggcgtggaattttgatctcggtaaaaca
caggttcagagttttctgatttcaagcgccgaatattggctcgaccagtgtcatctagat
ggcttgcgagtggatgctgtctctaacatgttgtattgcgactatgatgaagggcgcgaa
gggcaggttaatcagtatggggataatcgtaatttagaaggcatcgcctttttacaaaag
ttgaacaccacggtcttaacccaccatcccgatatcttgatgattgcggaagagtcgtcc
gcctatccgcaggttacgggttcggtggccaatggcggattgggatttaactataagtgg
aacatggggtggatgcacgataccctggatttctttatgatggatccgttatatcggcac
gatcactttaatctactgacatttgcattcgtgtacatgttcgatgaacggtttattcta
ccgttttcacatgatgaagtcgtgcacggcaagaaatcattaatgcataaaatgtcgggg
gaccgctataatcagtttgcaaatttgcggacgatgctaacttatatggctgcctttcca
ggaaaacaactgaattttatgggttcagagtgggggcagtttctagagtggcgggactgg
agtgcgttggaatgggtcgacttaaaggatgatctcaaccatcggatgcaacagttcaca
acgcaactgaacgcggtctatcggcacaatcggccgttgtgggaacaagaccatgatcct
gcggggattatttatacacataccgatgatcctgacagttcgaccatggggtttatccgg
caggccaaacgaaaatacagttttgtggtcgctgctttcaattttgttcctgttgaacgt
caagattaccggattggcgtaccgtatcgtggccgttatgagttgttactcaatactgaa
gcgcaggcttttggcggcacgtggacaaagctagaaacaacgtttacggcggtcgataag
ccgtatcgggggcaaccagctagttttaccgtgaccttgccggcgatgggtgcattgttg
attcgaccagttaaagtgatagggggagttaagcatgcaagatga

DBGET integrated database retrieval system