KEGG   Lactobacillus plantarum WCFS1: lp_0354Help
Entry
lp_0354           CDS       T00115                                 

Gene name
rpiA2
Definition
ribose 5-phosphate epimerase
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:lpl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lpl01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lpl00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322679..323347
Genome map
AA seq 222 aa AA seqDB search
MTIKQAIVQQALTLIKPQMVVGFGGGSTVGELVKEAANHVNDITVVTPSPTTRQLATVLG
YTVVDTAYCDRVDIAFDGCDQLDHHGNALKSGGGIHANEKIIASLADEYWLLTMQDRLVD
QFDIKTPLVLEVLPAALSLVMRTVSDLGGQATIRTANNRDGFTLTDSGNLLIDCHFPTYA
KLTDLNVELATLAGVVETSYFDHLVTNAWLGDATTNTVKALF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaaacaggcaattgttcaacaagccttgacgttaataaaaccgcaaatggtt
gttggttttgggggtggctcgacggttggtgaactggtcaaggaggcagccaatcatgtg
aatgatattacggtcgtcaccccatcaccgacgacccgccaacttgcgaccgttctcggg
tataccgttgtagatactgcatattgtgaccgcgtcgatattgcttttgacggctgcgat
cagttagatcatcacggtaacgcgctcaaaagtggcggtggaatccatgctaatgagaag
attattgccagcttggcggatgaatattggctgttaacgatgcaggaccggttagtcgat
caatttgatatcaagacgccactagtcttagaagtactgccagcggccttatcgttagtc
atgcggacggtgagtgatcttggtggtcaggcaaccattcgaactgctaataatcgggat
ggcttcacgttaaccgatagcggcaatttattgatcgattgtcattttccaacgtatgcc
aaacttacggacctgaatgttgaattagcaactttggctggcgttgttgaaacgagctat
tttgatcatttggtgacgaatgcttggttgggtgatgcgaccacgaatacagtcaaagcg
ctattttaa

DBGET integrated database retrieval system