KEGG   Lactobacillus plantarum WCFS1: lp_0371Help
Entry
lp_0371           CDS       T00115                                 

Gene name
glpD
Definition
glycerol-3-phosphate dehydrogenase,FAD-dependent
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    lp_0371 (glpD)
Enzymes [BR:lpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     lp_0371 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340417..342246
Genome map
AA seq 609 aa AA seqDB search
MAFSATTRQQNIERLQNETLDLLVIGGGITGAGVAIQSTAMNMKTGLIDMQDFAEGTSSR
STKLVHGGIRYLKTFDVGVVADTVKERAVVQGIAPHIPKPDPMLLPIYDETGATFDLFSV
KVAMDLYDKLAEVKDPKFTNYTLSREEVLQREPQLNPKHLVGGGVYLDFRNNDARLVIEN
IKKAHENGGIMASHVKATGLLHDDDGRINGITAEDLLTGASFEIHARIVINTTGPWSDTI
RKMDHTEKYQSQMRPTKGVHLVVDAEKLPVPQPTYFDSGDQDGRMIFVVPRENKTYFGTT
DTDYHGDLKHPTVTQEDVDYLLEIVNRRFPTAKITLDDIEASWAGLRPLIAANGSSDYNG
GNSGKISDKSFKEVIKVVDQFESQEASREDVESVLNDLETSLAEDKLSPSAVSRGSSLTS
SPDGLLTLAGGKITDYRKMAAGAMALIAKILADKYDAHFNEINSKNLPVSGGDIDPHNVD
ATIAFYAKQGTDNGLTNDEALRIANMYGSNAARVFSLIGKVEPTHGLSLAETISLRYALD
EEMTLTPVDYLLRRTNHLLFMRDTLDGLKDGVIATMADYLGWDAATVKAQTELLNQTIAE
SDLTALKQG
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcagcaacgacgcgtcaacaaaatattgaacgcttacaaaatgaaacgtta
gatttactcgttatcggtggtgggattaccggtgccggtgtcgccattcaatcaactgca
atgaacatgaagaccgggttgatcgatatgcaagactttgcagaagggacttcatcacgg
tcgacgaaactggtccatgggggtattcgttacttaaagacgtttgacgtgggggtagtc
gccgataccgttaaagaacgggcggtcgtccaggggattgcgccacacattcctaagccc
gacccaatgttattgccgatttatgatgagacgggagcgaccttcgacctcttttctgtc
aaagtggcgatggatctgtatgataagctcgccgaagttaaagatcctaaattcaccaat
tataccctttcgcgcgaggaagtcttacaacgggaaccacagctgaaccctaaacattta
gttggtggcggtgtttaccttgattttcggaataatgatgcgcgcctagtgattgaaaac
attaagaaggctcacgaaaatggtgggattatggcaagtcatgtgaaggcgaccggcctc
ttacatgatgatgatggccggatcaatggtatcaccgctgaagacttattgactggtgca
tcgttcgagattcatgcccgaatcgtcatcaatacgaccggtccatggtcagacacgatt
cgtaagatggaccatactgaaaagtatcaatcccagatgcggccaaccaagggtgtacat
ttagtcgttgacgctgagaaactcccagtgccacaaccaacctattttgattctggtgat
caagatggccggatgatcttcgtggtgccacgtgaaaacaagacgtatttcggaacgact
gatacggattatcatggtgatctgaaacacccgaccgttacgcaagaagatgttgattac
ttgttggaaatcgtcaaccgtcgctttccaactgctaaaatcaccttagatgatattgag
gctagttgggccggattgcggccactgatcgccgctaacggtagttctgattataacggt
ggtaattcaggaaaaatcagtgataagagcttcaaggaagttatcaaggttgttgatcag
tttgaaagtcaggaagccagtcgtgaagatgtcgaaagtgtcctgaatgacttggaaact
tccttggcagaggacaaactcagtccgtcagcggtttcacgcggtagttcgttgactagt
agtccagacgggctgttgacccttgctggtgggaagattactgattaccgtaaaatggct
gcgggtgccatggcgctgattgccaagattttagcagataagtatgatgcccactttaat
gaaatcaattcgaagaacctccccgtttctggtggcgatattgatccgcacaacgtggat
gcaacgattgcattttatgctaaacaagggacggataatggtttgacgaatgatgaagcg
ttgcggattgcaaatatgtacggttccaatgctgcgcgggtctttagtttgattggtaaa
gttgaaccgacgcatggtctgagcttagctgaaacgattagcttacgttatgccttggat
gaagaaatgaccctgacgccagtcgactacttgctgcggcgcactaaccacttgttattc
atgcgagatacgctggatggcttaaaggatggcgtcatagcgacaatggccgattatctt
ggttgggatgctgcaacggtcaaagcacaaaccgaattattgaatcagacgattgctgaa
tcggacttaacagcactgaagcagggctaa

DBGET integrated database retrieval system