KEGG   Lactobacillus plantarum WCFS1: lp_0406Help
Entry
lp_0406           CDS       T00115                                 

Gene name
plnJ
Definition
(RefSeq) bacteriocin precursor peptide PlnJ
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(366872..367039)
Genome map
AA seq 55 aa AA seqDB search
MTVNKMIKDLDVVDAFAPISNNKLNGVVGGGAWKNFWSSLRKGFYDGEAGRAIRR
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgaacaaaatgattaaggatttggatgtagtagatgcatttgcacctatttct
aataataagttgaacggggttgttgggggaggcgcttggaaaaatttctggtctagttta
agaaaaggattttatgatggcgaagctggcagagcaatccgtcgttaa

DBGET integrated database retrieval system