KEGG   Lactobacillus plantarum WCFS1: lp_0440Help
Entry
lp_0440           CDS       T00115                                 

Gene name
pbg1
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lpl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
393593..395029
Genome map
AA seq 478 aa AA seqDB search
MTIKGRAFPEGFLWGGAVAAHQLEGGYKEGGKGLSTADIMTLGTNERPREITDGVVAGKY
YPNHQAIDFYHRYPEDIELFAEMGFKCFRTSIAWTRIFPNGDESEPNEAGLQFYDDLFDE
CLKNGIQPVVTLAHFEMPYHLVKQYGGWRNRKLIQFYLNFAKVCFERYRDKVTYWMTFNE
INNQTNFESDGAMLTDSGIIHQPGENRERWMYQAAHYELVASAAAVQLGHQINPDFQIGC
MIAMCPIYPLTAAPADVLFAQRAMQTRFYFADVHCNGTYPQWLRNRFESEHFNLDITAED
LKILQAGTVDYIGFSYYMSFTVKDTGKLAYNEEHDLVKNPYVKASDWGWQVDPVGLRYAM
NWFTDRYHLPLFIVENGLGAIDKKTADNQIHDDYRIDYLTDHLRQIKLAVLEDGVDLIGY
TPWGCIDLVAASTGQMSKRYGFIYVDENDDGSGSLKRYKKDSFTWFQHVIATNGAEIE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaaaggacgagcgtttccagaagggttcttatggggtggcgcagtggctgca
catcaactcgaaggtggttataaagagggcggcaagggtctcagtacggcagatattatg
acattagggacgaatgagcgccctcgtgaaattacggacggagtagtggctggcaagtat
tatcctaatcatcaggcaattgatttttatcatcgttatcccgaagatattgaattattt
gctgaaatggggtttaagtgttttcgaacatcgattgcctggacgcggatcttccccaat
ggtgatgaaagcgaaccgaatgaagctggattacaattttatgatgatttatttgatgaa
tgccttaaaaatgggattcaaccagtagtgacactagcacactttgaaatgccatatcac
ttagttaagcaatacggtgggtggcgtaatcgtaagcttattcaattctatttaaacttt
gcaaaagtatgttttgaacgttatcgagataaagtaacgtactggatgacttttaatgaa
atcaacaatcaaactaattttgaatcagacggtgccatgttaacagattctggaatcatt
catcaaccaggagaaaaccgtgaacgctggatgtatcaggcggctcactatgaactggtg
gcgagtgccgcggcggtacagttaggccatcagattaatccagattttcaaatcggttgt
atgattgcgatgtgtccgatctatccgcttacagcagcaccagcagacgtcttatttgcg
caacgagcgatgcaaacccgattttattttgccgatgttcattgcaatggcacttaccca
caatggttgcgtaatcgttttgagtcggagcattttaacttggacattacggcagaagat
ttgaaaatcttgcaagctggaacggtagattatattggatttagctattacatgtcgttt
actgtgaaggacacaggaaagctagcttataatgaagaacatgatttagttaaaaatcca
tatgttaaggctagtgattggggctggcaagttgatcccgttgggttacgctatgctatg
aattggttcacggatcgttaccatttgccactgtttatcgtggaaaacggtttaggcgca
attgataagaagacggcagataaccagatacatgacgattatcggattgactatttaacg
gatcatttacgacaaattaagctggcagttctggaagatggggttgatttaattgggtat
acgccatgggggtgcattgatttagttgcggctagtactggtcaaatgtccaaacgctat
gggtttatctatgttgatgagaacgatgatggttcaggtagtctaaaacgttataaaaag
gattcatttacttggtttcaacatgtgattgcgacaaatggtgccgaaattgagtag

DBGET integrated database retrieval system