KEGG   Lactobacillus plantarum WCFS1: lp_0500Help
Entry
lp_0500           CDS       T00115                                 

Gene name
deoK
Definition
deoxyribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    lp_0500 (deoK)
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     lp_0500 (deoK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
447195..448118
Genome map
AA seq 307 aa AA seqDB search
MADVTVIGSNMIDLTTYIGRMPVEGETIEAPEFNIGYGGKGANQAIAAARLGSDVNFITM
VGNDGFGQEQLANYQKNGIRTDGIGIGHQNSGVAPIFVDPSSDNRILIIKGANKELTPAV
LDEKQALIKNSKLIVLQQEISLETNYHAIDLAQQFGVPVLLNPAPANKNLNIDYVSKVVF
FTPNETELATLTGLPTNNLDEIKVAACDLISRGVENLIITLGHKGALWVTENHAEIVPGM
KVKAVDTTGAGDSFIGSFAHYFAQGEAIPDALQHANQYAAMTVMKKGTQKSYPTAAELSD
LLAAAVD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgttacagtaattggctctaatatgattgatttgacaacttatattgggcgg
atgcctgtcgaaggcgaaacgattgaggcgccagaattcaacattggctacgggggtaag
ggtgctaatcaagccatcgcggcggcacgcctaggttcagatgttaattttattacgatg
gttggtaatgatgggtttggacaagaacaactcgctaattatcaaaaaaatggtattcgt
acggatggtattggcattggtcatcaaaatagtggggtagccccgattttcgtagatcca
agcagtgataaccgtattttgattatcaagggggctaacaaggaactgactcccgctgtt
ttggatgaaaaacaggcactaatcaagaatagtaaactaattgtgttgcaacaagaaatc
tcgctagagactaattatcacgccattgatctagcacaacaatttggagtgccagttctc
cttaatccagctcctgctaacaagaatttgaatattgactatgtctcgaaggttgtgttc
tttacgcctaatgaaacagaattagctacgctaactgggttaccaacaaataacctggat
gagatcaaggtcgcggcgtgtgatttgattagtcgtggcgttgaaaacctgattattacg
ttgggtcataagggcgcactctgggttactgaaaaccatgcagaaatcgtcccaggaatg
aaggttaaagccgttgatacgactggcgctggggattcatttattggtagttttgcccat
tactttgcacagggtgaagccatcccggacgcgttgcagcatgcgaaccagtatgcagcc
atgacagtgatgaaaaagggaacccaaaagtcatatccgacggcggcagaactttcagat
ttgttagctgctgcagtggattaa

DBGET integrated database retrieval system