KEGG   Lactobacillus plantarum WCFS1: lp_0524Help
Entry
lp_0524           CDS       T00115                                 

Definition
(RefSeq) toxin-antitoxin system, toxin component DNA-binding protein, PemK/MazF family
  KO
K07171  
mRNA interferase MazF [EC:3.1.-.-]
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     lp_0524
Prokaryotic defense system [BR:lpl02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MazF-MazE
    lp_0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
469802..470194
Genome map
AA seq 130 aa AA seqDB search
MAAADIKRGDIFYADLSPVVGSEQGGMRPVLIVQNNVGNHYSPTVIVAAITAKVQKAKMP
THVNINAAHTGIEKNSVVLLEQIRTIDKQRLKDRVTHLDDQTMRRVDNALQISIGLADRT
RRRPQRTFQS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagctgacattaagcgtggtgacatcttttatgcagatttatcaccagtcgta
ggctccgaacaaggaggcatgcgtccagtactaatcgtgcaaaataatgtcggtaaccat
tacagtcccacagtgattgtcgcggcaatcactgctaaggttcaaaaagcgaagatgcca
acacatgttaacatcaacgctgcccatacggggattgaaaaaaattcggttgtgttgttg
gagcagatacgaacgattgataagcaacggcttaaagatcgcgtcactcatttggatgat
cagacgatgcgccgagttgataatgcgttacagattagtattgggttagctgatcgaaca
cgacgtcggccacaacgcacgtttcaatcatag

DBGET integrated database retrieval system