KEGG   Lactobacillus plantarum WCFS1: lp_0535Help
Entry
lp_0535           CDS       T00115                                 

Definition
(RefSeq) hypothetical protein
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-GeneID: 1061870
NCBI-ProteinID: YP_004888538
UniProt: F9UL09
Position
complement(483062..483700)
Genome map
AA seq 212 aa AA seqDB search
MLLKTLVKPKERLVTITADATLEDALKVLEDSGFRCIPILDETGHIFRGNIYKMHIYRHK
SRGGDMSLPVTTLLKNATKTIQVDSAFYNIFFSIKDLPYIAVLDEHGYFYGILTHTRLLD
MLSQSWNVNVGSYVLTVVSVGERGDLAAMAKIITKYTSIAGCLTLDVQNGTLGYRTLFTL
PENVDSEKLKRIIDNLNRKQFKVIEVEDLQAE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctattaaaaacactcgtaaagcctaaagaacgcctcgtcaccattacggcggacgcg
accttagaggacgccttaaaagtcttggaggattccggcttccgctgtattccaatctta
gatgaaaccggtcatatcttccgcggcaacatctataagatgcacatctatcggcacaag
tcacggggcggcgacatgtcgcttcccgtgacgaccctgcttaaaaatgccacgaaaacg
attcaagtcgactccgccttctacaatatcttcttctccatcaaagatttgccatacatt
gcggtgctcgatgaacacggctatttctatggcattctcactcatacgcgtctgctcgac
atgctctcacaatcttggaacgttaacgttggtagctatgttttaacagttgtctccgtt
ggtgaacgcggcgaccttgcagccatggctaagattatcacgaaatatacttcaatcgcc
ggctgcctgaccttagacgtccaaaacgggacactcggttatcggacgctctttaccttg
ccagaaaatgtcgacagtgaaaagctcaaacgaattatcgacaacttgaatcgcaaacaa
tttaaagtcatcgaagtggaagatttacaagctgaataa

DBGET integrated database retrieval system