KEGG   Lactobacillus plantarum WCFS1: lp_0536Help
Entry
lp_0536           CDS       T00115                                 

Definition
(RefSeq) cell surface protein, ErfK/YbiS/YcfS/YnhG family
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PG_binding_4 YkuD
Motif
Other DBs
NCBI-GeneID: 1061885
NCBI-ProteinID: YP_004888539
UniProt: F9UL10
Position
complement(483855..485249)
Genome map
AA seq 464 aa AA seqDB search
MKHKRGLMIGGSILGLLVIGYVATSLIWQHQQTFLSNTSVAGVDVSGKTAAQAAPKVNRA
LEHRTYRIIENGQTKYSFTSKSAGITINTKKDLTKLVTKQNYWRWPLALLQSAQADDSSA
VGQLTINHTDLKTLLQKITTTANQTKRTKTENAKLVYQHNQVEIKKEVQGTELDQAKLKT
VVTKAISNGDSHITLKDAYVTPTVTSTSASLKTAKAKSAKYATEKATYNINGHKFTIPHD
LILSWIKVDKQGKVSLDQNAVLTYVKQLNDKYHTYHTTRQFKSTARGTVSVSGGFYGWTI
KTEAEAKALATEILKGKDFTRSPITSGSGYNNKGTDIGNTYVEVDKENQHMYVYVDGKLT
VSTDIVTGKPGKHATTTGVWYIWNKEKNATLKGDNDDGSSYSQPVSYWMPFDDTGEGIHD
SSWQTQYGGTWYKKHGSHGCVNTPPSVMKKVFAAVPVGTPVIVF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaacataaacgtggacttatgattgggggcagtatcctcggtctcctcgtcatcgga
tatgttgccacgagcttaatctggcaacatcaacaaacgttcctcagtaatacgtcggtc
gctggtgttgacgtcagtggtaaaaccgccgctcaagcagcaccgaaagttaatcgcgct
ttagaacatcgcacttatcgaattattgaaaacggccaaacaaagtactcatttaccagc
aaatcagccggtattacaatcaatactaaaaaagatttaaccaaattagtgaccaaacaa
aactactggcgttggccccttgcactattgcaatcggctcaggctgatgatagctcagcg
gttggacaactaaccatcaatcacactgatttgaaaaccctactacaaaaaatcaccacg
actgccaatcaaaccaaacgaacaaaaactgaaaacgccaagttagtttatcaacataac
caagttgagattaagaaagaagttcaaggaaccgaattagatcaagctaaacttaagacg
gtcgtcaccaaagcaattagtaatggtgacagtcatatcacccttaaagacgcctacgtc
actccgaccgttaccagcacgagtgctagtttaaagacggccaaagcaaaatcagcgaaa
tacgctaccgaaaaggccacctataatatcaacggtcataaattcacgattcctcacgac
ctaattctcagttggattaaagtcgataagcaaggcaaagtaagtttagaccaaaacgct
gttctgacttacgtgaagcaattgaatgataagtatcatacctatcatacgacgcgtcag
ttcaagagtacggcgcgtgggaccgtatccgtcagcggtgggttttatggctggaccatt
aagaccgaagcagaggccaaagcccttgctactgaaattttgaagggcaaggactttacc
cgctcaccaatcaccagtggttccggatataacaacaagggcactgacatcggcaacacc
tacgtcgaagttgataaagaaaatcagcatatgtacgtctacgttgatggaaagctcaca
gtttcaacggacatcgttactggaaagcccggtaaacacgctacaacaacgggtgtttgg
tacatctggaataaggaaaagaacgcgacccttaaaggtgataatgacgatggctcaagt
tattcccaaccagtttcttattggatgccgttcgatgacactggcgaaggaattcacgat
tcttcatggcaaactcaatatggtggtacttggtacaagaagcacggctcgcatggttgt
gtgaacaccccaccttctgtcatgaaaaaagtttttgctgccgtgccagtcggaacacca
gtcattgttttctaa

DBGET integrated database retrieval system