KEGG   Lactobacillus plantarum WCFS1: lp_0538Help
Entry
lp_0538           CDS       T00115                                 

Gene name
pth
Definition
(RefSeq) peptidyl-tRNA hydrolase
  KO
K01056  
peptidyl-tRNA hydrolase, PTH1 family [EC:3.1.1.29]
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     lp_0538 (pth)
Translation factors [BR:lpl03012]
 Eukaryotic Type
  Release factors
   lp_0538 (pth)
 Prokaryotic Type
   lp_0538 (pth)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
486761..487318
Genome map
AA seq 185 aa AA seqDB search
MKMIVGLGNIGRQYAQTRHNVGFMIVDELASKLNVTFQTSKFEAQVATAFQDGEKILLVK
PATYMNDSGRAVGPLMSYYNVDPADLLVIHDDLDLPLGKVRLKQKGSAGGHNGIKSIISH
VGDQHFKRVKVGIDHPQKMSVVDYVLGKFTPAEVAKFDDAKITALAAVEAWLANDDFTAV
MNQYN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgatcgttgggttaggcaacattgggcggcaatatgcccagacacgtcataat
gttggttttatgattgtggacgaattagctagcaaactaaacgttacgtttcaaacgagt
aaatttgaagcacaggtggcaacggcttttcaagacggtgagaagattttactggtgaaa
cccgccacttatatgaatgattctggacgagcggtgggaccgttgatgagctattacaat
gttgatcctgctgatttgctcgttatacatgatgatttagatttaccactaggaaaagta
cgcctcaaacaaaagggatcggcgggtggtcataatggcatcaagagcattattagtcat
gttggtgatcagcacttcaagcgcgttaaagttggtattgaccatcctcagaagatgagt
gttgttgattacgtgttggggaaatttacgccagccgaagtggcgaagtttgacgatgct
aagattacggcgctagcggcggtcgaagcttggttagcaaatgatgattttacggcagtt
atgaatcaatataactag

DBGET integrated database retrieval system