KEGG   Lactobacillus plantarum WCFS1: lp_0541Help
Entry
lp_0541           CDS       T00115                                 

Definition
(RefSeq) ribosome-associated heat shock protein
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S4 S4_2 CC2D2AN-C2
Motif
Other DBs
NCBI-GeneID: 1061892
NCBI-ProteinID: YP_004888544
UniProt: F9UL15
Position
492641..492928
Genome map
AA seq 95 aa AA seqDB search
MSMRLDKFLKVSRIIKRRSVAKEIADKGRIQINGKVAKSSSNVSVDDELIISFGNKTLTV
KVTQLLETTKKNDAELMYDIISEDYKTDYRQPFSD
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgcgtttagataagtttttaaaggtttcacgaatcatcaagcggcgctctgtt
gctaaagaaatcgccgataaggggcggattcaaattaacggtaaggtagcgaaatcttcc
agtaatgttagcgttgatgatgaactaattattagttttggaaataagacattaacagtc
aaagtgacgcagttattggaaacaactaagaaaaatgatgccgagctgatgtatgacatc
atcagcgaagactacaaaacggattatcgccaaccatttagtgattag

DBGET integrated database retrieval system