KEGG   Lactobacillus plantarum WCFS1: lp_0565Help
Entry
lp_0565           CDS       T00115                                 

Gene name
nadC1
Definition
(RefSeq) nicotinate phosphoribosyltransferase
  KO
K00763  nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00760  Nicotinate and nicotinamide metabolism
lpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    lp_0565 (nadC1)
Enzymes [BR:lpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     lp_0565 (nadC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAPRTase LEH QRPTase_N
Motif
Other DBs
NCBI-GeneID: 1064234
NCBI-ProteinID: YP_004888565
UniProt: F9UL36
Position
520575..522053
Genome map
AA seq 492 aa AA seqDB search
MTQIYPDDSFTLHTDAYQINMIQTYWEQGIHNKHAVFEVFFRKMPFRNGYAVFAGLERVV
NYINHLHFTATDIAYLRELGGYSDGFLDYLANFKFDATIRAVREGDLVFNNEPLLQVEGP
LATCQLIETALLNIINYQTLIATKAARIKSVVGEDGLLEFGTRRAQEFDAAIWGTRAAYI
GGFDATSNVRAGKIFGIPISGTHAHALVQTYRNDYQAFKAYAETHHDCVFLVDTYDTLRS
GVPSAIRVAKEMGDKINFQGVRIDSGDMAYLSKRVREQLDEAGFPDAKIYASNDLDEKTI
QNLKMQGAKISVWGVGTKLITAFDQPALGAVYKMVSIENDHHQMVDTIKLSNNAEKVSTP
GQKQVWRITKRADGKSEGDYVTLYDEDPRNEESIYMFHPSYTYINKTVSDFDARPLLVPI
YDRGQQVYTLPTLDEIKEYSFESLDALWDEYKRDLNPQDYPVDLSQKLYDHKMNIINTVR
DHVNHKDEEEAY
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaatctatccggatgatagttttaccttgcatacggatgcttatcaaattaat
atgatccaaacctactgggaacaaggtattcacaacaaacatgcggtgtttgaagtgttc
tttcgtaagatgccgttccgaaatgggtacgcggtatttgcgggtctggaacgagttgtt
aattatatcaatcatttacattttacggcaactgacatcgcatatttacgtgaactgggt
ggctactcagacggttttctagattatttagcgaatttcaaatttgatgcgacgattcgt
gcggttcgtgaaggagacttggtctttaataatgaaccgttgttacaagtcgaaggacca
ctggccacttgtcagttaattgaaacggcactactcaatattatcaattatcaaacgttg
attgcgactaaagcggcgcgcattaaatcggttgtcggtgaagatggcttactagaattc
ggtactcggcgggcgcaggagtttgatgcggccatctggggaacccgggcggcttatatt
ggtggctttgacgcgacgagtaacgtgcgggctggcaaaatttttggtattccgattagc
gggacccatgcgcatgcgctcgtgcagacttatcgaaacgattatcaagctttcaaggcc
tatgcggagacccatcatgactgtgtctttctagtggatacgtatgatacgttacgtagc
ggggtgccgagtgcgattcgagtggctaaggaaatgggtgataaaatcaatttccaaggg
gttcgtatcgatagtggcgatatggcttacttatcaaaacgcgtgcgtgaacagctagac
gaagctggttttccggatgccaagatttatgcgtcaaatgatttggacgaaaaaacgatc
caaaacttgaagatgcaaggtgcaaaaattagtgtctggggtgttgggacgaagctaatc
acggcctttgaccaacccgcgttaggggccgtatacaagatggtttcgatcgagaatgat
catcatcagatggttgatacgatcaaactttcaaataacgcggaaaaggtctcaacgcct
ggtcaaaaacaagtttggcggattacgaagcgtgcggatggcaagtcggaaggtgactat
gtgacgttgtacgatgaagatccgcgcaacgaagaatcaatttacatgttccatccaagc
tatacgtatattaataagacggtcagcgattttgatgcgcgaccactattggttcccatc
tatgaccgcggtcaacaagtttatactttaccaacgttagatgaaatcaaggagtattca
tttgaaagtctagatgcactttgggacgaatacaagcgggatttaaaccctcaggattac
ccggtcgacttgtcacaaaaactttatgatcataaaatgaatattattaacacggtcaga
gaccacgttaaccataaagatgaggaggaagcttactaa

DBGET integrated database retrieval system