KEGG   Lactobacillus plantarum WCFS1: lp_0584Help
Entry
lp_0584           CDS       T00115                                 

Definition
(RefSeq) transport protein, major facilitator superfamily (MFS)
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 1061537
NCBI-ProteinID: YP_004888583
UniProt: F9UL54
Position
556941..558182
Genome map
AA seq 413 aa AA seqDB search
MQEYMCNRGYQTLINVAVLSGIGDGLYNIVFVIYAGSLSFSTLAVSLASMATLVPSLLSM
LTGYFADQSRHKVRAILVTRNLQFVLFLILAFLITLPRNIWLFFLLLSINIVSDTLGTYG
NGLALPLLRHLLPENKLKQSMGFMVAMTLMAQVVFQGIGSVIIVMLHHNYMVVGLINALT
FLLSALLVKYRFGVLCVAEPQMVERKQVSMIRSLGLTLRYLYRNNFLFSVIILTFFINVF
GASMSGLINVTLLSVKTMWLVNYGISVAIMNMMISIGMITGSLVTNGIVRKLPLMYLFAI
SLSFSGLCGISFIWHESAYLSIVLLFVMGYFIGKINPRISAIVLQSIPEKRLAAVDGLLN
MVSMLGAPVGQLLFLGIANVVGIAYSWFAFSIGCFFLIVIIVLKFIKMDEPMF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatatatgtgtaaccgtggttatcagacattaattaatgttgctgttttaagt
gggataggagacggactatataatattgtttttgttatatatgcaggctcattatcattt
agtacgttagctgtatcattggcatctatggcaacattggtaccatcattactatctatg
cttacagggtactttgctgatcagtctagacataaagtcagagcgatactcgttacgaga
aacttacaatttgttctgttcttaattttggcttttttaattactttaccgagaaatatt
tggctgttttttttgctattatcaattaatattgtttcagacacgcttggaacatatggt
aatggcctagcgctgccgttattacgtcatcttttgcctgaaaacaagcttaagcagtca
atgggatttatggtggcaatgacattaatggcacaagtcgttttccaagggattgggtct
gtaataattgttatgttgcatcataattatatggttgtcggattgattaatgcactaacc
ttcctgttatccgcattacttgttaagtatcgttttggagtactgtgtgtggcagaaccg
caaatggtagagcggaagcaggtttctatgataaggagtctaggactgaccttacggtat
ctgtatcgtaataattttttgttcagtgtgatcattttgacttttttcattaatgtattt
ggagcttcaatgtctggattaattaatgtaaccttattatcggttaaaacaatgtggctg
gttaattacggaatcagtgttgctattatgaatatgatgatttcaattgggatgataact
ggctctcttgttacaaacggaatagttaggaaacttccgttgatgtatttatttgcgata
agcttatcattttcagggttgtgtggcatcagttttatttggcacgaatcggcgtattta
agtattgtattacttttcgtaatgggatacttcatcggtaaaataaatcctcgaatcagt
gcgatagtgttgcaatcaattcctgagaaaagattggccgctgttgatggactattgaat
atggtcagtatgctcggagcaccggtgggacaacttctttttttaggaattgcaaatgta
gttggcattgcatatagttggtttgccttttcaataggttgctttttcttgattgtcata
attgtacttaaattcattaaaatggatgaaccaatgttttag

DBGET integrated database retrieval system