KEGG   Lactobacillus plantarum WCFS1: lp_0597Help
Entry
lp_0597           CDS       T00115                                 

Gene name
pgm2
Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lp_0597 (pgm2)
   01230 Biosynthesis of amino acids
    lp_0597 (pgm2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_0597 (pgm2)
  Energy metabolism
   00680 Methane metabolism
    lp_0597 (pgm2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp_0597 (pgm2)
Enzymes [BR:lpl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     lp_0597 (pgm2)
Exosome [BR:lpl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   lp_0597 (pgm2)
  Exosomal proteins of melanoma cells
   lp_0597 (pgm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
570711..571388
Genome map
AA seq 225 aa AA seqDB search
MTELVLVRHGESTANRDNTYTGWSDVPLTAVGIAQAHQAGKRLRATGLQFGAVHTSVLKR
AIVTANIMLSEIDQLWLPEYKTWRLNERHYGALRGQNKDVTRQEYGKAQVQQWRRSFYTV
PPLLTPAELDHDRRYTKYGAAVEPRGESLKMAYDRIMPYWIDEIAPRLLDGQNQLVVAHG
STLRAMIKYLEHISDTGIDGVEVANGVPICYHLDRQLHVIGKEEY
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacagaactagtattggttcgccatggtgagagtacggccaatcgggataatacgtat
accggttggagtgacgtcccgctaacagcagtgggtattgcacaggctcatcaagctggc
aagcgattacgagctacgggactgcagtttggcgctgtacatacctcagtcctaaaacgg
gctatcgttaccgcgaatattatgttaagtgaaattgatcagttatggctgcctgagtat
aagacgtggcggttaaatgaacgacattacggtgccttacgtggtcaaaataaggatgtg
actcgtcaagagtacggtaaggcgcaagttcaacagtggcggcggagcttttatacggtg
ccgccgttgttgacaccagctgaactagaccatgatcgacgttacaccaagtacggtgcc
gccgtcgaaccgcggggagaaagcttgaagatggcttacgaccgcatcatgccttattgg
atcgatgagattgcaccgcggttgttagacggccaaaaccaactcgtggtggcgcatggt
agtacgttgcgtgcgatgatcaaatatttagagcatattagtgatactgggattgatggt
gtcgaagttgctaacggagtgccaatttgttatcaccttgatcggcaactgcacgttatc
ggtaaagaagagtattaa

DBGET integrated database retrieval system